CAZyme Information: MGYG000003077_02111

Basic Information

• Species: CAG-196 sp002102975
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-196; CAG-196 sp002102975
• CAZyme ID: MGYG000003077_02111
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000003077_14|CGC1	42263.47	9.3098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003077	2204918	MAG	Spain	Europe

• Gene Location: Start: 7507; End: 8625 Strand: -

Full Sequence      

MKKIFIITGEYSGDMHAGRVAEILKQKNPDIEIEGIGGENLKKAGAKIYCDHSKMSGFGF
SIKMALDHIALEKKVADYLLNSYKPDLVLLIDYGTFNLRVAKRLKGSGIKVFHYIPPQVW
ASRKWRIKGIKKYVDEVLCIFPFEIEMYQKEGINVHYCGHPLIKQLPEKADREQFFAKHG
LDTTRPLVSIFPGSRTIELRFLANTFIKSAKQLQKKHPEIQFCISHAPNLSDDIFDKYIN
GTDFKVIKGENQALLSISDSLILASGTVALEAALYQIPMIIGYKGPWILYLAYLMVRCIK
KVSLPNIITGEDIVPELIQAKFNTENICYETEKNLYNKEYRIGFIKALGKVKEKLSDKYS
AEEAANEIIKTL

Enzyme Prediction     

No EC number prediction in MGYG000003077_02111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1.9e-104	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.61e-118	1	372	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.30e-102	1	372	1	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.17e-77	4	364	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.78e-65	4	327	8	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.01e-43	1	355	1	332	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.45e-176	1	372	1	372
AKQ33376.1	2.84e-71	2	372	6	376
AEH45383.1	4.24e-71	3	365	10	369
AWH84955.1	1.56e-68	3	372	2	369
ADY50863.1	2.02e-68	3	335	2	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.05e-41	4	327	9	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.88e-41	4	327	9	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	4.50e-67	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9NCA7	6.33e-67	2	365	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
B6J9H1	6.33e-67	2	365	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	6.33e-67	2	365	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	6.33e-67	2	365	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003077_02111.