CAZyme Information: MGYG000003087_00958

Basic Information

• Species: Merdibacter sp900543035
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900543035
• CAZyme ID: MGYG000003087_00958
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2321		251344.99	3.8311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003087	2304658	MAG	Spain	Europe

• Gene Location: Start: 29486; End: 36451 Strand: +

Full Sequence      

MSKLFERIGKTTLAIALALPTLSTGVTVFANDENTESQTDAGTETSASYPAAQDGYTYVS
SVASVSQEANDVTLTLEAGERIRFRFLEGNVFRMYMAAPGEEFQEYPTPNSSDHSATITN
KTDADYYTDYKVEPQLIEDDSTVTMIAEGGITITVDKATAMMTVTNAQGETVIKEAAPIQ
YRNGSTIQTLATSPDEYFYGGGTQNGRFSHKGEVINITNSNNWVDGGVASPNPFYWSTNG
YGVVRNTWKPGAYDFTSDETITTTHNEERFDAYFFVDDSAAGILKDYYELTGNPVELPEY
AWYLGHLNCYNRDYWLEVDEGTRGAVKLGDKWYRESQTDNGGERETLNNDDNISARAIID
EYEDYDMPFGWFLPNDGYGCGYGQTDSFQGDIDNLQAFADYAISKGVQTGLWTQSNLWPA
DPDNPQKGERYIYAEVDAGVHAVKTDVAWVGAGYSMALNGISVAYDAITSRSGMKPTIVT
LDGWAGTQRYGGIWTGDQSGGQWEYIRFHIPTYIGTSLSGQPNIGSDMDGIFGGGDPTIW
TRDFQWKTFTTYMLDMDGWGSNQKSPWAMGQDGTSINRAYLKLKAQLMPYINTISHEGTA
AGGLPMIRAMFLEEENEYTLGTATQYQYMFGDNFLVAPIYQDTAADEDGNDIRNDIYLPS
TSDVWIDYFTGEQYRGGQILNYFDAPIWKLPLFVKNGSIVPMYPENNNPEAITETNPNGL
DDSQRIVEFWPAGSTEFEAYEDDGKTLGGASATTLYTSVVDGDTATLTANKTIGQYTDMT
HERSTEFIVNVSQEPTAVTGSVAGQDVTFTKVDSMKALEEAEGNVYFYDPSPSVYVTQFA
DEGSSIADLDATSTPKLYVKSGAKTNISEYDFQVVVEGFANEQTLPANELDEALTVPANL
REVDKSDDYITVGWDAVDGINAYDIEVDGTVFNNIEATTYTQDDLMFSTEHTYRVRSVSA
DGHYSNWSEPIMLMTDDDPFRNTPYPTDIDWEGTIYSNRTADRAFDHTFQIGDGGFHSGG
GDIGKALTVDYGMAYQLDKIEYYPRDDAGNGTVTQMEIATSIDGIHWSEGQVYTFARDNT
TKTVEMDGVTARYVRFIPRASVGNFFSASEILVYKVDGTNGSIVGDVNHSGSLDENDLTF
YENYIGLIPSDSDFEYIKDSGGDIDGNDIIDAYDLSYVATQLNGGISNPADGVDGKIMLV
PDKTDIKAGDTVNISIFGIGLKNVNAFSVEFHQDDSLFTVTNPGSASVSTAFMRNFSKLR
THTSASEGIDNYTVFTNLGFQDLINGTGTIATITIQANADFTWGNDRVASSATLVGQDLS
TVDAIIDLTDKPEAPETSSILTPGNGIESITFDNEHLTNSDGSELWQQGNWQTLLFDGAT
SGSMAEFKWYYGAEQDNIGPEVMLPTDFNIDLDGTRHITNFTVYGRTSGNGTLRTSQLVA
YNGDEVVYESDVVEGSTPVFEINADVDRIVWTPLTSDGRATDTSTGSEYNRMLSLFEIEI
EEDAAVPATGITFDETSVSTLSVGDFGEVFATVTPSNATNPFYHIASDNDEVATVTEIPM
GDHYTYLVQGTGVGTATLTATTEDGKHTATWQINVTDELNTDRLMEEIEKVNSLYENLYT
EDSWAAVEEAVAAAQALIGDPNTTKADIDNATIAIMSAVDALEFKGSNEDQPSSENLISH
DGMSMFDESSCSAVEQEHASNVLDDNTNTIWHSNYNSGYTLPQWFTIDQGGTYNLEQVDY
LPRQGGSHNGMVTHYRIETSLDGETFTPIVEGYLETDGNSLKDPTTFKEIKFDATEARYV
RFIAIESLGDTPNTYASCAEMNFYGTLVSAPGADFSDLQDAIAAADALDAEDYTTSSWAA
FETVLNAAKELTEESSAEQISNAIASLSAAQAALEARASQASIDALAATVANAEALRDQY
TSEAFADVDAAIQAANALIAEPADASSAEVVSATLNISVAVQKLNNQPSTDKLRANLEAT
IAYAKVQVEEAVNARPGAIDAVNAAIEAGETVLADENATADDYKEAITNITKAVQELWDI
VSKDELNAVITEAEAITADGYTEDSYNNLQNAIAAAKEVAENDDATTSEVTNAITSVLDA
IAGLVREGLNTSVLENWIETVEQMVANIDDYRPSTVVGLEDKLNEAKEVLANATTQEEID
EAAQTLMEAALNARTKADVEALAAAIAQAEALDLSKYTPASAQAVKNALANAKALLADPE
ADQDTVDGMTNALLSAIDNLQDVTTTPGGSTDEPGTTPDDGNTDTDNNGESGTGAGNGGT
QTNGSGTAAENSTVGFAAMSVVALGALAAAFKKRNTLKKDR

Enzyme Prediction     

No EC number prediction in MGYG000003087_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	461	700	2.5e-55	0.5292740046838408
CBM32	1692	1821	3.3e-23	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	4.74e-168	290	671	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	7.70e-59	143	786	103	742	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	5.27e-53	273	700	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06589	GH31	2.49e-38	292	581	1	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06603	GH31_GANC_GANAB_alpha	9.15e-37	465	702	201	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK85989.1	0.0	6	2172	2	2112
QIK69254.1	0.0	55	2240	43	2257
QJA02122.1	0.0	13	1829	12	1878
QBJ76643.1	0.0	3	2251	5	2220
SLK21224.1	0.0	3	2251	5	2220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	7.49e-285	54	981	32	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	4.04e-284	54	981	32	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.11e-283	54	981	32	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
4LKS_A	3.03e-29	1692	1825	33	166	Structureof CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LKS_C Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LQR_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124],4P5Y_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with N-acetylgalactosamine [Clostridium perfringens ATCC 13124]
2XVG_A	2.14e-24	478	810	639	978	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	4.50e-29	196	776	147	745	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	1.19e-24	475	747	566	821	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q5AW25	3.60e-24	182	711	164	707	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
Q4R4N7	6.27e-24	466	747	585	852	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
B9F676	1.05e-23	475	746	564	818	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998940	0.000226	0.000184	0.000163	0.000141

TMHMM  Annotations     

start	end
2294	2311