CAZyme Information: MGYG000003087_00966

Basic Information

• Species: Merdibacter sp900543035
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900543035
• CAZyme ID: MGYG000003087_00966
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1502	MGYG000003087_18|CGC1	162089.4	3.9877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003087	2304658	MAG	Spain	Europe

• Gene Location: Start: 652; End: 5160 Strand: +

Full Sequence      

MKNSSKRLMKGLLAVMLICSSFWLPVETKAADGTTQADSQTVTKIQAEDAQLSLPSGSDM
SSAFVFEQEPASDEGGHIKTSVLGASVTLEFEGTGIRFYTKKGNGAGQLSVSVDGEEPQT
VDEYIDSTTAQFKVKVYEDLELSADNEAHTIVLTTLDGDRTNFNFDYFEVIADQEEEPDP
DLEETVTTVQAEDDEYVTLDPALGSSMSDSFVKEAEPNSNGGAHIKTSVIGATLTLRFEG
TGVRFYTKKGNGAGKLSVTLDGEDLGEIDEYIDSTSAQFQEMVFAREGISVNNEEHTLVL
TTVDGERTNFNFDCFDIISLEKKDTYIPSPGNTTYYLDSTAAVGGDGLSEGSAFDSLDDI
NQIEFAPGDRILIKAGSSFLGQLYPKGSGSAEAPVIIDMYGEGEKPLIDGNGRYSDAPSV
HDDGPFGEAGSAVYLCNQQYWEINNLRVRNWSDDNQDKERSGIRVEAYGGGTYHHIYIRN
CEISDIRGYNGQDSIWDVVPENGGTTFYGARTTHRTGGINIVSYTKRDTSGGLGTAGAIL
DDQPTIFDDVLIEDNTIENCHANGITTHNVRGELDDKAYRHTHVVIRGNEIRNVQRAGIV
PLYTSGALVEHNLVDTFQQTYAGYGCGIWCDRADGMLFQYNEVCNGRNTMDGMAFNLDDM
TENGIIQYNYTHNNVGGGIMLHVRTNSYNRNNIVRYNLSVNDTQGYAAHQAIVVCVGEDA
NTKIENAKVYNNTFINNNVVHPVYQGDEILFENNIFYLPNEGMSARNDAYVVGANTTFRN
NVFAGSHPASEPSGNGNVSVSESPVAGTFYGSESLDEALDMAKLRHGSAALGIGDDTLIT
QDGVETDVYGNPAGGEQVNAGIYNGESVDPLPDAGDPGTNPDLDEEPDEDEYRVEYVEAE
SESVEKSPGYVLVEGSGSQGHANSHIYYSNTGTWVEYTFTGKAISVYSKTGPGAGTIDIL
LDGEQVGVDDQYTAAQTFNKRAYTKVFEEEGTHTIRLENNGLKNPSATGNSFNLDCFKIF
HEKEDNADLRSIRYQIGNGEAMTIEGFDPTITEYDVTLPAGTYGEIRLIAEAESTLADIQ
ADPVTIENGKAEGVITVTAENGTEKTYRIHFTVESSSDSIASDAAIDALRNMVDKAVALG
SEDDALNAAIESAQAVLAKEEPTSAEVVTALLDLSEAMQALNTSESIDALRADVQATIDF
INENILANVDGIRPGKVDALEAAVEAAQKLVDDPEASADELKAANRAMTKAAQELWEIVS
KAELNALIEAANGYLDGNYTEESLAALQTAITAAQAVAANEDATTTEVTEAITNLANAIA
GLETIQLDTSALEHEIELVSEMIANIGNYVPSTVEGLADKLDDAQNVLENAATQDEIDAA
TKTLREARLNARTKADTSALEELIEYINSLDLRAYTTESAQALIQELARAENLTNDPEIT
QEEVDDMVKDLQASVDELVEVNNSTNAEESTSTAAMNMTNAMFALMLAAGAAAAAAYRRK
KQ

Enzyme Prediction     

No EC number prediction in MGYG000003087_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	332	853	8.3e-97	0.9755600814663951

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.70e-08	548	754	9	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
TIGR02168	SMC_prok_B	4.72e-06	1147	1462	676	988	chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
cd04079	CBM6_agarase-like	1.65e-05	896	1017	5	130	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
COG1196	Smc	0.001	1195	1470	555	863	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].
pfam12733	Cadherin-like	0.003	1047	1112	10	87	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35145.1	7.04e-198	323	1472	26	1294
AZG68471.1	6.23e-126	293	761	73	560
QNK55088.1	3.31e-70	319	869	44	544
QJD84649.1	3.12e-66	333	868	255	739
QNK55089.1	8.74e-65	316	868	239	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	1.36e-34	333	855	9	568	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
6KQT_A	3.13e-24	335	705	247	620	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	1.54e-22	335	705	247	620	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH9	1.63e-08	1259	1445	1666	1862	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.998462	0.000523	0.000214	0.000209	0.000175

TMHMM  Annotations     

start	end
1475	1497