CAZyme Information: MGYG000003087_01166

Basic Information

• Species: Merdibacter sp900543035
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900543035
• CAZyme ID: MGYG000003087_01166
• CAZy Family: CBM40
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1670		179176.33	3.8743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003087	2304658	MAG	Spain	Europe

• Gene Location: Start: 25470; End: 30482 Strand: +

Full Sequence      

MKKRTTQTYSILLASMLGVSSVVPASMMPVMAQTVRASATRTYAEGEMVSVNGGEGAIDA
SSDVSAFVGLEDFTFNATFTVTGSSVNSLFFLGDSTRQNNYITVYVNGHTIGVESRDASG
AQQISGATVTLNDVDFSQQHKLTFTMDGGNLYRIYLDGEMVKEGSVSVNFSAGLFDSADY
MGFGNGKRANGGNPYPLTGSIGDIELYDSALSEEDILSYHRGELGNAVYTYENAYGESVN
DTEGLSAVKDLTQGSISVRYRINDPADGPMMLMAVSDGTQDRSYLGLYVNPASNQLGFDA
PGNALFSGKTLSLSRYGKSIADTSWHTLTVTKADGGIRFYLDGEYLDQYTNGITSGFFNT
VSSPDSLGIGYVNRATGNEMALDGAIDYVNVYGSVLSESEIALEHETTAWEPDQAPDMSN
AYKSDPIDLYYTGYQNVTAYRIPSLLTTSAGTQLAFIDERNSGAGDAGNIDAVVRRKSAD
SDTFSAPITLIDLPNNGGSAAFTIDASAVQDQETGRIFMLIDMFPESSGLMDTSQLTTGT
GYKEVDGEMCQILYYNDGTHAEAGVIRNVDENGIGHVYDDEGNDTGYTVIVNTGGASDEK
GNLYKDGEYKGNIYMLRNGPDKGELVVLNTTYLWLVYSDDDGQTWSDPVDITPQVKEDWM
VFLGTGPGAGIQLQDGNLVFPVYSANTNVGASQSSAVIISEDHGETWKLGDSPQTLRGYD
RETMTGGGMLTESQAVQLNDGRVLLFMRNSISNHVYMATSTDGGMTWDSIEEISELNEYY
CQLSVIHYNKDDGEYLLLSNPNVSGRYDGWVHLGKVNEDGSISWEYAQQLNEGKFQYSCL
SVLENDGENPVFGLLYEDDTDGSFDIKYTEFDENFVKAPLITEELSAPQIVDSSAEIDGT
DITVTLTFDQDIMAVGTPKLELTLGTEAFEADYADGSGTETITFKGTLPEGVKGIVRAKG
ISLEEGLLENIRNKGVDEIDLELYDLTRITEGLSIHDYSSQQSASTAPDTDGAAVNVLDG
NVRTYWHSVWSDASYQLPQYVSVDLGETQEIYKVGYVGRYGNANGRIEEYSISVSTDGEH
YTEVQCGTFQNIDGEQQVEFAPVEARYVRMTAYSAYGNGGTQSCSMAEMMIYAYAEGVIE
QGDLTALNELIASVQELDADTYSAVSWAALQEALEDALAISTSQDPVSQAMIDSARDALQ
DAADALVDITRVKDKLAEAEALDESDYTEASWAALQTVLAQAREQMDQATSSREVTDIVM
RIDNAMNALVEEVSDTASEAAVQALHDMVDKAVALGSDDAALNAAITNAQAVLAKEAPAT
TEVVTALLDLSEAMQALNIDESTDALRKDVQATIDFINENILNDVEGLRPGKVQALKDAV
QAAQTLLDDPKATADALKTANKAMTKAAQELWEIVSKAELSALIEAANGYLAGDYTADSL
EALQTAIESAQAVAANENATTAEVTEAITNLANAIAGLEVITLDTSALVHEIELVNEMLA
NIDNYVPSSVEGLADKLADAQNALENAASQAEIDEAVKALREARLSARTKADVSALEALI
AQVNALDLRAYTLDSVVPVNRLMTLLTQAVNDPEITQAEADDLAAQMQAAIDQLQPVSEE
STSAESGAQTSDDASAADTSAAAQSGMFAAVLGAAAGMLTLMKRRKGQKR

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	431	866	4.4e-92	0.9473684210526315
CBM40	52	217	1.3e-33	0.9217877094972067
CBM40	233	403	7.1e-29	0.9273743016759777
CBM32	1000	1130	1.7e-23	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.92e-78	428	872	2	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam00754	F5_F8_type_C	1.21e-23	1003	1124	3	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG4409	NanH	1.83e-23	338	845	178	692	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	2.76e-19	619	838	71	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd00057	FA58C	1.19e-14	999	1109	17	125	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI03144.1	7.82e-106	200	952	43	772
ALG47932.1	4.04e-105	200	952	172	901
AXH51610.1	1.36e-104	200	952	172	901
BAB80259.1	1.85e-104	200	952	172	901
ATD49562.1	1.85e-104	200	952	172	901

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVZ_A	2.85e-83	437	882	25	477	Structureof the catalytic domain of Streptococcus pneumoniae sialidase NanA [Streptococcus pneumoniae],2VVZ_B Structure of the catalytic domain of Streptococcus pneumoniae sialidase NanA [Streptococcus pneumoniae]
3H72_A	6.20e-83	437	880	27	477	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]
2W20_A	9.65e-83	437	876	23	469	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
7A54_A	2.06e-82	437	876	50	496	ChainA, Sialidase A [Streptococcus pneumoniae],7A54_B Chain B, Sialidase A [Streptococcus pneumoniae],7A5X_A Chain A, Sialidase A [Streptococcus pneumoniae],7A5X_B Chain B, Sialidase A [Streptococcus pneumoniae]
2YA4_A	3.31e-82	437	876	44	490	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	3.83e-95	152	977	126	933	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62576	8.48e-86	203	973	114	873	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P62575	8.48e-86	203	973	114	873	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
Q27701	2.04e-42	236	857	99	729	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	7.83e-29	617	1131	159	643	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004156	0.994384	0.000322	0.000454	0.000346	0.000293

TMHMM  Annotations     

start	end
9	31
1640	1662