CAZyme Information: MGYG000003087_01773

Basic Information

• Species: Merdibacter sp900543035
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900543035
• CAZyme ID: MGYG000003087_01773
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1418		154741.15	3.9606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003087	2304658	MAG	Spain	Europe

• Gene Location: Start: 19962; End: 24218 Strand: -

Full Sequence      

MEKLEKKLLKISMAASCTLSLLMPNVAMAQENDQATESVQAEIYPKPQKMEYLSTEGMKL
EGTVNLVVHGEQNEATVTKVKELLTAENISFVEADEVDDSQATILITTDASHCDDCAAPA
NADTTVLEEEQGYILSASNDENAKGEINIVGADEDGAYYGVMTLTQMMEQGKEDGTFAET
VISDYPDVKLRGFVEGFYGYPWDFEDRLSLMSESSKFKMNTYIYAPKDDPYHKDQWRELY
PDDKAEELRQLAEEGKKDNMSFCWSVHPGYGFNYNTDDDYNALIRKFEQLYDLGVRQFGI
SYDDLSGSYSGQDHADLINRVNREFVQKKGDVKPLIVVGTRYCNGWGPDMQTYFKPFFSS
LDDDIVVMWTGANTMSAITKEAYEWPKTQTGVDKDLAAWWNYPVNDYCDGNLMMSPLENL
DNDVDNLSGFFLNPMSQAEASKVAIFSGADYSWNIGDFERTSSWKRAIAELVPEANEAFE
RFADNISYIKDGFEFDESRYLVEDITNFQTALKNNMGIKEAAEVLKADFTQMKEDVALLR
NINNANLLEEITMHLNAYEAVAEAGIASMNAFIAAQDGIIDDCLTNITQTEIKLNESETY
QIESLETNGTKMNVVKVGEKRIKPLLRDSISQIKDLLMDTVFPQANPAVIGTMEGIDEVK
VIAAQGNYTINDVAGTLNAGESIGIRLPKAMKVGSIATEIGTAEGLKLQYSVNGHEWTDA
DSLNADINTTATYVRILNDTDAAIELNLTSLTVKPIYNVGVMKAETDLGTYEGTMANTID
GNIHTKFYSSAGATVGSYARVDLGKEIPLYDVSINYAGNPKGPGHGIDGFAATKLEISTD
GVSWTQIGDIINDENYVEKTIDGQLVNSADYNAEGQMARYIRFTATEASANWVQIFEIMF
NESEGSLGDDTIDIASSTFEDGTLYNLYDRDLTTAFAPTAVKDGDTLNFDMTTITDVGNL
MIMQDAEAISNAVVSVKGVDGTWKEVGTLNKELTTLAINDTITEVQLTFNSANPAPVIYE
IIAQEQSEDPGDQETASEAAIAALQNMVDKAIALGSDDAVLTEAIANAQAVLAKEAPTVT
EVVTALLNLSEAMQDLDQEASEDALRADIQATIDFINENILNNVEGIRPAKVQALKDAVQ
AAQTLVNNPGATVDELKAANKAMTKAAQELWEIVSKAELNALIEAANGYLDGDYTTESLD
ALQAAIESAQTVAINDNATTAEVTEAIMNLSDAIANLETITLDTSALEHEIELVTEMIAN
IGNYVPSSVEGLQEKLDAAKTALNNATTQAEIDEATKTLREARLNARTKADTSALEELIA
YVNSLDLSAYTKESAQAVIQDAARAEIMTNDPEITQAEVDDMVKTLQASVDNLVEVKNST
NAEDTTNTAAAAQTGLFAGVLAAAAGALLAIRRRKNQE

Enzyme Prediction     

No EC number prediction in MGYG000003087_01773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	191	483	6.5e-103	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.54e-130	191	482	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	2.18e-10	42	184	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	1.31e-09	770	898	9	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
TIGR02168	SMC_prok_B	4.69e-07	1019	1319	762	1041	chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
COG5281	COG5281	8.43e-04	963	1370	78	475	Phage-related minor tail protein [Mobilome: prophages, transposons].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33733.1	0.0	1	1237	1	1239
QAS61890.1	0.0	1	1237	1	1239
ATD57955.1	0.0	1	1231	1	1240
SLK13973.1	0.0	1	1231	1	1240
QBJ74644.1	0.0	1	1231	1	1240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OXD_A	1.09e-92	45	574	20	546	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	1.21e-92	45	574	18	544	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
6PV5_A	1.80e-92	31	569	32	572	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
4ZXL_A	3.91e-92	45	574	10	536	CpOGAD298N in complex with Drosophila HCF -derived Thr-O-GlcNAc peptide [Clostridium perfringens ATCC 13124]
2YDQ_A	5.24e-92	45	574	20	546	CpOGAD298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XL08	3.72e-88	27	819	30	819	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	9.27e-88	27	819	30	819	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q89ZI2	2.18e-85	126	721	95	693	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	3.01e-69	1	986	1	1027	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.08e-29	190	451	61	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000353	0.998557	0.000462	0.000228	0.000196	0.000166

TMHMM  Annotations     

start	end
1389	1411