CAZyme Information: MGYG000003087_01807

Basic Information

• Species: Merdibacter sp900543035
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter; Merdibacter sp900543035
• CAZyme ID: MGYG000003087_01807
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1745		191913.14	4.0691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003087	2304658	MAG	Spain	Europe

• Gene Location: Start: 10698; End: 15935 Strand: +

Full Sequence      

MKKMIKRMCLSVLALMVAAGSLIGSYGIEAHADDALPQERILLDDDAGEMQEYAAKELQK
YLYQLFGTWLPIMDLDADTDVSHAFVLGTKEDAASLKPIEAEIESIGEQGYVLKKSEDTL
YIGGHDDAGLLYGVYGLLDDHYGIGFYFSGDVIPEEQGEFYMPEVDEAKTPRQYMRGILP
WTNFPQSSTVYSLEDWKYVIDQMARMRMNFLNIHNYNGQNGHNEMFHNFTYDGITSRNWN
ATAGSGHGWYGPAWDVNEYRFGASDLFDDYDFGMDATLHNDSLSNTEVFAKGYSMFQYII
QYAHSRGVKIGLGLDIDLVMPDYGVSADAPGLPELQAETVMANYEDLDTLILYISEMIVS
DPAALSRWRDCFDRMYETVRAKRPDMQIAVSGWGISEEIARSLPDDVVIAPISNYSAGFV
NGSEAYPGKEYWGGPWVERDFDSSVYYYPYNMELSDTVKAYQENKDTMQGLFTLTWRLSD
AVDPKIMYIAKAPWDSEEKYQSAEDVYREYAQKCYGQENAEDMGKLLYADEKTVVPTTWS
ECNDTVQFTGADREADIARVQQMIDRVEQAMQRTDDRGNQARLDKLRNRLIGVQAYCRLD
QGFNTTDWAHLQDDFATWGRSFINRIDDISSLGNIVSTQNRFVQLRYVARETQLRNEQEI
KAPLNVSAEGTADGAQISWEYEQNQADGFYVYRDGERISPLLSGSARTYADVYDQAASYT
VRAVNAQGQEGEASIAQTCLAGSGDQEAPQVFVVSPPTSVIEGQDLQVKARVLDGRVDAC
ISAQIHYRPMGSEEAFVSEPMERRVKSVFTASLDTAGFADTGIEYYITVSDGDNQSVWPA
TAPQLNAVCTVSEDPQGAHAVKAPMEIMAENGEISWSAAEGDVFWYRIYRSDDPDFEPSM
ANFITYVEGNTTQFSDVDRDIDGSKLSDQTMYYKVTAVDDQLNESIPTQAVEVRGRDIDP
LRTTLFADADALNNSSVSAQSGSLSGQVVGFTRAGGHAMFEQLRFSPERGYDAVEISYSS
ETAGSSLAVWIDAPDAGSGGTKLGEATLGGTGAWDSFATAIIPLDIPMRGTHDVYFVYGT
GGGYFYNLDTFRFTCTQDTSADAVTLTPNDLMADRRSLASGMKEELSQISGFGSEGDRIV
LGTGYRAGAENTSMAGGTTLVDLPGYPGLKCYANIRYGGQSFTFSDLSAGKAYFAYDKAY
AGAEHQLALYVNEEKHSDLMLPDSTGSDWNNADHKIMYADTGITLEEGDSLKFAFEHVAD
DNWLLNGVKLFVEQPYSGEQINIEYANQEDTQFSVYVNGQKEETITLPDSDGQRAVFSLV
KHVDQDIIALAVDAEDAEVNAGASAVIYQIDLLKEAQRTTRTISVSHNAGGSVTPDGEWE
VDYGASQTIAIQPDPGYRISSVVVNDVDHGAISSYTFERLTYDADVQVTFEAVPQEDVFD
ITLAQSEHGSVTASHSSASAGQPIQLSVQPETGYHLKQGSLVYVSASHPEGVAINAASLQ
FTMPREPITIQAVFEPDVSKTALEELVGEANQLDEGSYTADSWSMLMRALEEAERILAAE
GATQDEVDAAEEKLSLALDALVRIEDKTELNALIEKAEAYLEGEYTAESIAALRTAIDAA
KIVADDADAAAEEVSEAITNLSSAIAGLEKIRLDTSALEHEIELVSEMLASLDDYVPSSV
EGLADKLAAAKETLMNAAEQSALDEATARLREARLMARTKADISALKAQAKWLISDPEVS
QADVD

Enzyme Prediction     

No EC number prediction in MGYG000003087_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	979	1094	4.9e-16	0.7681159420289855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	2.67e-18	973	1093	10	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam03422	CBM_6	2.81e-14	968	1094	4	124	Carbohydrate binding module (family 6).
smart00606	CBD_IV	1.46e-11	970	1093	14	129	Cellulose Binding Domain Type IV.
cd04080	CBM6_cellulase-like	1.25e-09	986	1094	47	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd02795	CBM6-CBM35-CBM36_like	7.94e-07	968	1093	6	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBW21394.1	3.93e-219	6	953	2	1069
AKA50869.1	3.93e-219	6	953	2	1069
BAD47589.1	1.08e-218	6	953	2	1069
ANQ59507.1	2.96e-218	6	953	2	1069
CAH06509.1	5.79e-218	6	953	2	1069

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V4V_A	7.42e-09	973	1094	14	128	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002875	0.995402	0.000364	0.000563	0.000399	0.000347

TMHMM  Annotations     

start	end
9	28