CAZyme Information: MGYG000003091_01205

Basic Information

• Species: Parabacteroides sp900547435
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900547435
• CAZyme ID: MGYG000003091_01205
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		42097.73	6.3136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003091	3044653	MAG	Spain	Europe

• Gene Location: Start: 7281; End: 8378 Strand: -

Full Sequence      

MNKYVILAALLVLLSACGGHKHTPFDTKMHASLERSLTWRTDSTGIWETAGWWNSANLLT
AVIRYGEITKNKKEIVPVIEDVFQKAKHYAVADSTGKFHHYCDNFINDFYDDEGWWALAW
INAFKLTNDKKYLEMAEVIFEDMTGGWSDDVCGGGIYWRKNPHHYKNSIANNLFALTAIR
LYNETGKNKYADWFKKEVDWYLQTGMYNTEIHQIEDGLKEDCTPNRNAHYTYNQGVAMAV
LTEMYMYSHEKKYLKMAEDIAKATITKELVTEEGILREMNPNVAISNDGVQFKGIFIRHL
GFLYKVTNNPLYRDFIIRNAESIIRNNYDPETMSFGCYWYGPFHAVNAAANSSALECVME
AQAIY

Enzyme Prediction     

No EC number prediction in MGYG000003091_01205.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	37	352	3.9e-85	0.8547486033519553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	4.41e-44	52	340	35	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	4.69e-27	99	339	77	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.20e-07	179	341	39	176	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam00759	Glyco_hydro_9	0.002	84	200	180	290	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE28248.1	1.06e-183	1	361	1	358
QIX66371.1	1.14e-183	1	361	1	358
AST52979.1	2.14e-183	1	361	1	358
QUT96026.1	2.14e-183	1	361	1	358
BBK90205.1	2.14e-183	1	361	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	5.27e-36	106	326	87	301	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	4.54e-24	38	326	75	351	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.04e-22	38	326	76	352	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	6.73e-22	38	326	76	352	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6U4Z_A	2.45e-18	45	356	161	468	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O74556	1.58e-19	47	339	64	359	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
Q9P6I3	2.90e-19	32	302	29	312	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000088	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003091_01205.