CAZyme Information: MGYG000003091_01239

Basic Information

• Species: Parabacteroides sp900547435
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900547435
• CAZyme ID: MGYG000003091_01239
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000003091_56|CGC1	63974.98	9.0099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003091	3044653	MAG	Spain	Europe

• Gene Location: Start: 1349; End: 2992 Strand: -

Full Sequence      

MINQAERNPVRQWLLLVVVFCCAFFVNNEAIFVDIMESRNLITAREMVYDGNWLTPTMNG
ELRLEKPPLPTWIAAGIEFISPDNIGLQRAVTGMAGVLLAVFLYLLAFRLTRDRLYAFIA
VLLLCTSYSIVLMGRTASWDIYCHAFMVVAIYYLFQALQATTCHWRWFTMAGLMLGLSFL
GKGPVSFYALLLPFLCAYAVFYKINLTGKWKGCLWMLFLTLLISSWWYLYIYVSHPEMME
YVLKKESGSWINYNVRPWWYYWKFFLETGVWSLLTLTALLVPVWKKRLANPKPYYFTLVW
MLLVLFFLSLVPEKKSRYLLPIVIPAVLTGAHLFVYWIEQMKADDRWGRILYRMNAGLIM
LVTCALPFLLYKYMYSEMHMGLVAYLFLSLLCLGIGFGLYYAWRKVRPYSFLLGVVGLMM
VAELFLMPYIGSFVTNTERNSISQTRKIEALESLPFYRDSEESLRIELVYAAYRKILAID
LSDTLQVRKALPFALVSKEKAEEVLPEYWSDKVELTPIGRYDDNPWPEGHRRYTKDFINY
VTVIREK

Enzyme Prediction     

No EC number prediction in MGYG000003091_01239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	454	7.1e-64	0.8425925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.41e-25	13	436	11	433	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	9.72e-13	36	235	31	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
PRK13279	arnT	1.64e-12	44	398	40	393	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.58e-09	66	201	2	131	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	2.93e-06	51	179	76	206	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAR35928.2	1.87e-19	37	321	32	315
ADI85313.1	1.87e-19	37	321	32	315
AJY68843.1	1.87e-19	37	321	32	315
ANA39794.1	1.87e-19	37	321	32	315
BBA70984.1	1.87e-19	37	321	32	315

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.32e-18	10	321	2	308	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A6V1N8	1.56e-17	8	394	2	386	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
B4ETL9	3.69e-17	37	342	36	344	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
Q02R27	1.45e-15	11	394	5	386	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
B7VBN0	3.39e-15	37	394	32	386	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.756339	0.234078	0.003644	0.001513	0.001022	0.003414

TMHMM  Annotations     

start	end
13	35
86	108
115	137
141	158
163	180
185	202
214	233
259	281
294	311
316	338
351	370
380	402
409	431