CAZyme Information: MGYG000003091_01780

Basic Information

• Species: Parabacteroides sp900547435
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900547435
• CAZyme ID: MGYG000003091_01780
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		34607.82	10.1599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003091	3044653	MAG	Spain	Europe

• Gene Location: Start: 6048; End: 6941 Strand: -

Full Sequence      

MKVIFRLLLCCFCLLAFTDSWGENLSTLSSYHRYIRKYKDLAIEQQHKYKIPASITLAQG
LLESGAGQSDLARRSNNHFGIKCHDWKGKRVYHNDDRRGECFRKYNKVEDSYEDHSKFLA
LRSRYAPLFRLKITDYKGWAKGLQKCGYATDRKYANKLIKVIEDYKLYQYDSAKKKKSKQ
KKAIVQHTIYRSNGLLYVHAKSGDSLEDIAKSTGISARKLSKYNEIPKDFPLQADDVIYL
EKKKKKADDRHTRHIVQVGESMHSISQQYGIQVKSLYKLNKKDKDYVPAEGDVLKLR

Enzyme Prediction     

No EC number prediction in MGYG000003091_01780.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	40	167	1.6e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	4.43e-40	42	171	171	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	8.60e-37	26	171	38	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	9.24e-29	39	167	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	8.32e-27	34	171	11	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12711	flgJ	1.12e-18	47	158	231	351	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY57337.1	9.70e-143	22	297	22	302
QUT21858.1	9.70e-143	22	297	22	302
QUT55553.1	9.70e-143	22	297	22	302
ABR43831.1	9.70e-143	22	297	22	302
QKH98487.1	9.70e-143	22	297	22	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	3.12e-12	51	169	21	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.72e-12	51	169	22	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.48e-11	51	169	22	151	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	2.79e-10	19	171	18	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.21e-09	51	171	80	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.83e-15	48	171	65	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	1.18e-12	53	280	202	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	4.28e-10	30	169	160	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9X9J3	3.01e-09	34	161	163	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q2G222	1.73e-08	51	171	340	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000197	0.999232	0.000147	0.000143	0.000131	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003091_01780.