CAZyme Information: MGYG000003094_01358

Basic Information

• Species: Phocaeicola barnesiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola barnesiae
• CAZyme ID: MGYG000003094_01358
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000003094_24|CGC1	34077.95	7.8156

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003094	3093382	MAG	Spain	Europe

• Gene Location: Start: 2689; End: 3594 Strand: -

Full Sequence      

MTYLDPSNVYMCRDIATYTNIFIVEKEKGDTGDLYSVNDVPHGNVSKVWYDSPTLKMKRR
MTVYTPAGYDKGGHYLVLYLLHGAGGDEDAWTTLGRAAQIMDNLIAEGKAKPMIVVMTNG
NPNCEAAPGEWSKGMYKPSFMGHMESKPVASMEESFPDVVKYVEKNYRVLKGKKNRAICG
LSMGGGHSFSISKLYPDMFDYVGLFSAAIFMNGGNDSKKSALEQMNADPEFNRQMAALFG
AHPKLYWIAIGKTDFLYKSNADYRKYLDEKGYPYEYLETEGGHIWRNWRVYLTLFAQKIF
Q

Enzyme Prediction     

No EC number prediction in MGYG000003094_01358.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	52	293	3.5e-52	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	3.05e-26	39	301	63	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.00e-17	52	300	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.50e-15	62	292	38	301	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	6.48e-07	41	214	7	177	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
PRK06489	PRK06489	5.39e-04	53	232	48	214	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67052.1	1.92e-154	4	301	111	408
VEH16113.1	2.24e-148	5	301	115	413
QIX64683.1	9.72e-128	5	301	113	397
QUR47977.1	9.72e-128	5	301	113	397
QKH98968.1	1.95e-127	5	301	113	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	2.79e-84	4	301	93	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	9.33e-43	33	301	127	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	3.13e-32	33	301	105	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	3.19e-32	33	301	105	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.33e-31	38	297	25	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.25e-31	24	301	409	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	6.76e-29	38	297	44	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	4.37e-22	33	211	487	658	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	6.55e-22	32	301	130	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003094_01358.