CAZyme Information: MGYG000003094_01480

Basic Information

• Species: Phocaeicola barnesiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola barnesiae
• CAZyme ID: MGYG000003094_01480
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000003094_27|CGC1	41098.33	4.615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003094	3093382	MAG	Spain	Europe

• Gene Location: Start: 19624; End: 20688 Strand: +

Full Sequence      

MKKLIYTCLLAITALPAASQSLFEKYERFLTEPRTYTCFRTTEALNIDGKLDESSWLKAV
PTEPFVDISGEGFPTPKYETTAKMLWDDDYLYIGAVLEEDNIKAKLTQRDTIIYYDNDFE
VFIDPDNNGQGYFEFETNARGVLFDLILDKPYRTGGSFLIPWDCKDIKLAIHHEGTLNNP
TDKDKYWSVEMAIPHQAITWNFENPLKAGNIWRINFSRVQWLKEKGPEENWVWTPTGKVD
MHMPDRWGYLYLADSPVGSRIRVDWAPTCPSSIYKLMWAMFYAQLDAYAQNHSYQQSIDQ
FAITDKEREGLPTGTQIDLEASPNLYRISVTDPNTQTRYLLNNEGRFWSEKISQ

Enzyme Prediction     

No EC number prediction in MGYG000003094_01480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	47	252	1.9e-42	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	1.45e-74	47	249	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	1.01e-29	35	219	1	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
pfam06452	CBM9_1	3.22e-11	47	145	1	94	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	4.37e-09	46	194	3	137	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	8.03e-07	60	194	1	123	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND21566.1	2.33e-184	1	352	1	351
QUT85170.1	2.33e-184	1	352	1	351
ALK86129.1	3.30e-184	1	352	1	351
QEW35857.1	3.30e-184	1	352	1	351
QQY40681.1	1.33e-183	1	352	1	351

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004069	0.994522	0.000678	0.000239	0.000235	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003094_01480.