CAZyme Information: MGYG000003094_01683

Basic Information

• Species: Phocaeicola barnesiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola barnesiae
• CAZyme ID: MGYG000003094_01683
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000003094_34|CGC1	83749.7	5.3397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003094	3093382	MAG	Spain	Europe

• Gene Location: Start: 6083; End: 8335 Strand: -

Full Sequence      

MKTIPLLLSALALTVNGGAQNIVETSAYSWRGDTIFQGEFRAWAPSDDCILSTYSAQPGY
FMPVDKEWKVKNDLSPYPRLSSSNRLHNAIYNMGLDEMINNVEPDSTLRTGKEWSGVWTR
DVSYSIILSMGYLQPLASKVSLMKKVNANGRIIQDTGSGGAWPVSSDRMIWAVAAYELYK
VTGDRDWLEYIYPVISNSMEDDLQTLYGTSGLVRGETSFIDWREQSYPKWMQTVDIYQSE
SLSTSVVHYQALRVLADIAQELGKKQEAAKYAGLADKLKEVINRELWLDDKGFYAMYRYG
RNHLILNPRVETLGESLSILFGVAPQDRAERITQNNPNTPYGVAIFYPQIKDMPSYHNNA
LWPFVASYWALANAQVKNEVGALQAIGSVFRPAALFATNKENFNLDNGDIATELNSSNML
WSLAGNLALTYRMLFGIHFETDGLRFEPFVPKALSDTRTLTNFRYRNAVLDITVEGYGDR
IQSFTVNGKASEPFIGAKAKGKLDIRIVMANQDIAPMKVTYAPNRKAPLTPISRLVEMNG
ESYLAWNPIEYIAGYKVIRNGEVIATTRNTSYRLETPGEYQVLGFDENGIESFASEPVQY
HSILIQSLGGKATQLGSAQVSYQPTEPVSGFWGEGFVELDRQTGPVSIPLELPADGTYYL
ALHYANGNGPVNTENKAAIRTLLVDGQKVDTVVMPHRGQGNWYDWGLSNSIPVTLTKGNH
TLTIEFRPENENMNLNTNHALVDAVRIVCP

Enzyme Prediction     

No EC number prediction in MGYG000003094_01683.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	8.84e-16	629	737	21	122	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	1.48e-13	158	327	78	241	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	3.08e-09	114	473	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG3459	COG3459	6.25e-09	166	508	668	1051	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
cd04086	CBM35_mannanase-like	5.48e-08	629	725	20	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	2.48e-231	68	748	215	891
AKQ46615.1	9.66e-231	68	747	228	902
QEC58493.1	1.98e-230	68	748	199	875
QNK61875.1	6.37e-228	68	748	216	889
ARS34527.1	9.29e-227	32	748	200	897

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000521	0.998557	0.000353	0.000206	0.000181	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003094_01683.