CAZyme Information: MGYG000003094_02411

Basic Information

• Species: Phocaeicola barnesiae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola barnesiae
• CAZyme ID: MGYG000003094_02411
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		91109.18	5.6366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003094	3093382	MAG	Spain	Europe

• Gene Location: Start: 4353; End: 6785 Strand: -

Full Sequence      

MKQVCWLFWLCCLSLGIHAQSMRERICLDEAWQFALGNASSPASDFGCGTEYFNYLTKAA
SIHNEGPYALKFDASSWETVDLPHDWVVDLPYAAEASHSHGYKTIGYKYPETSVGWYRKT
ISIPASDFGKHLYLQFDGIFRDARIWVNGFFLGEEPSGYVTQVYDITDYLNYGGENLVVV
RVDASLEEGWFYEGAGIYRHVWLNKTAPVHVAPFGTFVSSDLSASLDEAKVSVQTTVVND
GIKEGTYRLNHLLKTADGRVIASVGNEEQPLQAKAQSVSTIQFTVDTPELWDVDRPYLYQ
LVTEVYQGVNLVDSYTTPFGIRQAVFDADKGFILNGKPLKLKGVNMHQDHAGVGVAIPDA
LQEYRLKQLKKFGCNAYRASHNPMTPEMLDACDREGILVIAENRLMGVNPYQLGVLGRMI
ERDRNHPSIILWSVGNEEWGIEWNEKGERIAASMREYCHRLDSTRLMTVASSSGPTVLVP
ADVAGYNYILQHKVDEDRMKYPERCAVGTEETSGCGTRNIYFNEVEKGWMASLNRIPNGS
DSLLNCIERGWKFYDERPWLGGLFYWTGFDYRGEPNPLKFPATGSQFGILDYCGFPKDEA
YYLKAWWTDEPVLHVFPHWNLQGHEGDSIDVWVYSNCEEVELLVNGKNLGKQPMPRNGHL
AWKTVYRPGKVKAVGYRAGHRCMVREIETTGEPYRVRVTVDRPEIQADKKDVAVVCVEIL
DKKNRVVPTACEPLDLKVSGPVRILGVGNGNPAFQEKERPEKADASSFKLNTFNGLAQIL
LQSTGDTGEATLTVCSEILKEGKITLQLIR

Enzyme Prediction     

No EC number prediction in MGYG000003094_02411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	671	1e-114	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.84e-68	20	603	7	624	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.31e-50	116	471	68	449	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.69e-48	49	466	46	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.81e-34	70	437	75	462	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	3.55e-29	329	584	5	278	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62078.1	0.0	1	808	1	812
QQA30544.1	0.0	1	808	1	812
QUT65074.1	0.0	1	808	1	812
SIP56251.1	0.0	1	808	1	812
BBK85901.1	0.0	1	808	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YPJ_A	9.05e-141	72	792	34	791	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.76e-140	16	808	18	820	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	2.22e-139	72	806	28	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
3GM8_A	6.73e-123	24	809	5	799	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6B6L_A	6.76e-118	73	806	30	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.50e-157	21	806	40	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.71e-99	73	809	71	821	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	2.75e-71	50	807	28	794	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	8.74e-67	68	746	23	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	9.48e-60	70	670	72	697	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999180	0.000144	0.000156	0.000142	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003094_02411.