CAZyme Information: MGYG000003097_00285

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_00285
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000003097_2|CGC2	51505.7	7.4771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 95539; End: 96942 Strand: +

Full Sequence      

MKKQMILAGLLICSLASGSMYAQEQLIAFPTAEGYGKYTVGGRGGEVYEVTNLNDSGKGS
LRAAIDAKGPRTVVFRVSGTIDLKSPLKIRNPYITIAGQTAPGDGICIKRYPLNISTDEV
IIRYIRVRLGDESKRADDAVSARYHKNIILDHVSASWSIDEVMSIYHCENVTIQWCMITE
SLFQSNHNKGNHGFGGIWGSNYSTYHHNLIAHHSSRNPRWASGSGLNDYRNNVLYNWGYN
SSYGGEKQQKGNPKFNSITVNFVDNYYKPGPATKPGNVSYRILNPSHTNGTNYGKWYVAG
NVVEGYPEVSADNWNGGVQIAGDKHILSAMKMNAPWNAMKINEQTPQEAYHAVLDGAGCV
RPVRDAVDCRIIEEVRKGTATYEGKAYKAKSKVADKSKVCGIIDSQEDVGGWPELKSLPA
PTDSDHDGMPDEWEKENGLNPNDAADRNQKTPDGYTSLEMYLNSLCL

Enzyme Prediction     

No EC number prediction in MGYG000003097_00285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	78	267	2.1e-78	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	7.62e-09	1	244	1	261	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	0.003	72	238	3	172	Amb_all domain.
pfam18884	TSP3_bac	0.007	423	444	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS04449.1	4.61e-226	20	465	15	461
QEG34169.1	1.11e-225	21	465	22	466
QQY83656.1	2.06e-222	20	465	15	461
AKP52261.1	3.58e-218	1	465	1	460
AEL26629.1	1.45e-217	25	465	20	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	4.08e-09	16	239	24	253	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CLG7	2.93e-60	18	465	12	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B8NQQ7	6.42e-58	20	465	14	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.94e-55	20	465	14	413	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
B0XMA2	1.99e-55	5	465	1	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	2.78e-55	11	465	7	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999020	0.000232	0.000163	0.000149	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_00285.