CAZyme Information: MGYG000003097_00906

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_00906
• CAZy Family: GH18
• CAZyme Description: Endo-beta-N-acetylglucosaminidase F2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000003097_6|CGC3	36038.63	4.8054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 106402; End: 107358 Strand: -

Full Sequence      

MKKILYFIVMLCCTTFVACDKQTTPEALDVQVPPTKSEDYFEALRQYKSSKHQLCFGWFG
NWTATGSAMSTRLDNVPDSVDIISIWGNTYNLTPEMKADMAYVQQKKGTKVIFTIFAHTV
PEMFIAEDGTIDYASYAKSLNDTIIKYNYDGIDFDYEPNYGGSGPLCNKDNMEVFIHEMG
KYVGPKSGTGKILSIDGEPYHMNPGLSEYFDYGIVQAYNSSGDTDLQNRFNQAANVGWKP
EQYIFTENFESLWQTGGNPNYHDKYGNVMPSLEGMARFTPEQGPKAGVGTYHMEYEYLAL
PTYKYLRQAIQIMNPTVK

Enzyme Prediction     

No EC number prediction in MGYG000003097_00906.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	57	250	3.2e-16	0.6452702702702703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	1.87e-71	23	312	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	6.91e-60	55	297	3	242	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd00598	GH18_chitinase-like	6.68e-11	77	219	34	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02871	GH18_chitinase_D-like	3.03e-07	57	223	5	198	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	8.16e-07	57	222	4	179	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH55047.1	1.95e-143	1	317	1	321
QIU95223.1	5.07e-124	1	315	1	318
BBL00953.1	4.89e-106	16	315	26	338
BBL06359.1	7.50e-106	13	315	21	328
BBL08878.1	9.74e-106	16	315	26	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	1.45e-46	34	314	53	356	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]
6KPL_A	5.42e-12	42	315	19	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in apo form [Cordyceps militaris CM01],6KPM_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris in complex with L-fucose [Cordyceps militaris CM01]
6KPN_A	5.96e-11	42	315	19	297	CrystalStructure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine [Cordyceps militaris CM01],6KPO_A Crystal Structure of endo-beta-N-acetylglucosaminidase from Cordyceps militaris D154N/E156Q mutant in complex with fucosyl-N-acetylglucosamine-Asn [Cordyceps militaris CM01]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36912	1.33e-18	20	315	28	335	Endo-beta-N-acetylglucosaminidase F2 OS=Elizabethkingia meningoseptica OX=238 GN=endOF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.262018	0.737369	0.000119	0.000115	0.000096

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_00906.