CAZyme Information: MGYG000003099_00380

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_00380
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000003099_2|CGC4	39264.44	4.7254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 189660; End: 190676 Strand: -

Full Sequence      

MKKIQFYIAAVLLLVSASCATRTETVSEPMPALKVTGNVFTDETGDTVRMTGVSFSDPDK
LEREGQWNLRYFQEAKRWGCNIVRFPVHTYTWRYRKAEEYLKLLDEGVEWAAQTGMYVII
DWHAIGNLPGDKYPHFNYATDWKETVNFWKTIAGHFKGNPTVAFYELFNEPTDVERPLSW
EIWRPMMEQLIDEINIVDDGKIYLVAGMNWAYLLDEVLENPVARRNVAYVTHPYPQKREQ
PWEPQWEEDFGKVADVYPVVATEFGFVIKGERGEHTPVVGDETYGNAIIDYFDSKGISYT
VWCFDPSWSPALLDDFDFTPSPRQGVFFKNVLQRNLKK

Enzyme Prediction     

No EC number prediction in MGYG000003099_00380.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	40	315	2.5e-116	0.996415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.74e-33	42	306	2	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.87e-14	71	310	78	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63367.1	9.53e-178	3	335	2	334
AHM60064.1	4.03e-120	35	334	20	321
CCG99506.1	3.24e-119	27	333	23	331
QNF32705.1	3.86e-118	1	338	2	338
QMU30925.1	5.85e-118	12	338	14	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	9.32e-100	26	335	45	358	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
5A8N_A	1.08e-94	33	338	51	365	Crystalstructure of the native form of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
5A8O_A	3.06e-94	33	338	51	365	Crystalstructure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with cellotetraose [Saccharophagus degradans 2-40],5A8P_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide B [Saccharophagus degradans 2-40],5A8Q_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A obtained by soaking [Saccharophagus degradans 2-40],5A94_A Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_B Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_C Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_D Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_E Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_F Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A95_A Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_B Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_C Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40]
5A8M_A	1.23e-93	33	331	51	358	Crystalstructure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_B Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_C Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
5WH8_A	8.89e-21	33	312	14	283	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	1.16e-15	33	302	116	369	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23548	1.48e-14	37	326	43	377	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
P07983	3.63e-14	13	302	22	291	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	5.83e-14	33	313	47	309	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P19424	1.63e-13	78	234	286	444	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_00380.