CAZyme Information: MGYG000003099_00852

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_00852
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000003099_4|CGC5	42434.19	7.8346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 230345; End: 231475 Strand: -

Full Sequence      

MKYYLVAGEASGDLHASNLMAALRREDSEAEFRYFGGDLMAAQGGTLVKHYRETAYMGFI
PVICHLDKVLRNIRDCKKDIEGWHPDVVILIDYPGFNMKIAKFVKTHLGIPVHYYISPKI
WAWKEYRIKGIKKYVDRMYSILPFEVPFYQRHDYKIDYVGNPTVDELAVRPDAGETFDHF
IADCSLPDKPIIAILAGSRVAEIEGNLRVMLEAAAAFPEYQLVIAGAPGIEPSFYKKYTE
GKAVSVVFGKTYRLLQQSKAALVTSGTATLETALLRVPQVVCYHMAGGKLVYGLFHWWLN
VRFVSLVNLIADDEVVTELLVHYFTPENVRKELGAILTDEAVRRRIAAGYERMADRLGEP
GAPARAARLIVESLHR

Enzyme Prediction     

No EC number prediction in MGYG000003099_00852.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	2.5e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.62e-106	1	376	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.04e-99	1	372	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.96e-71	4	371	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.89e-65	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.00e-43	1	332	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64292.1	2.24e-192	1	376	1	376
AHF12800.1	3.40e-188	1	374	1	373
QMI80442.1	7.69e-165	1	376	1	378
QPH59250.1	3.11e-164	1	376	1	378
QBJ18940.1	3.11e-164	1	376	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.71e-36	5	339	11	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.26e-35	5	339	11	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.69e-73	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	5.95e-64	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	6.93e-62	5	367	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	7.11e-62	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q3A550	1.58e-58	5	372	12	380	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_00852.