CAZyme Information: MGYG000003099_01315

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_01315
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000003099_7|CGC4	46345.53	4.9271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 100949; End: 102163 Strand: -

Full Sequence      

MKLFKSAGIGLSLMLLGSFASCQCKDDSKSLAIKIVDSEMQRYPESWQLDFQTKLKWDYC
LGLELQSFLDVYDKYGDEKIFDYALAFADTMVNEDGSIKTYKLKDYNLDRVNSGKFLFRI
YDKTQNPKYKKALDLLRSQLDTQPRNDDGGFWHKKIYPNQMWLDGLYMGTPFYAEYTHRY
VTDPEAQAAAYDDILNQILLVAKHTYDPANGLYRHACDISRQMFWADSVTGQSKHCWGRA
LGWYAMAIVDDLEFIPAEQPRRDEAVAIFNNIAEQLKKYQDAETGLWYQVIDRSGDEGNY
VESSCSAMFIYSLLKGVRLGLIDPSYLEVAQKGYQGYLKHFIEKGEDGLLNITQACAVAG
LGGKENRSGDYEYYINEKIRANDPKAVGPFIMAILEMEKVEENR

Enzyme Prediction     

No EC number prediction in MGYG000003099_01315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	399	4.3e-121	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.54e-118	34	399	4	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.46e-98	51	401	28	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT93209.1	6.92e-198	21	402	22	398
ALJ61262.1	6.92e-198	21	402	22	398
QDO69177.1	2.81e-197	21	402	22	398
QUT77882.1	6.24e-197	21	403	22	399
QDM11667.1	7.24e-196	13	402	15	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.50e-109	57	398	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.29e-79	56	398	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.54e-79	56	398	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.38e-17	25	346	41	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.03e-10	25	346	42	338	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.25e-78	56	398	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.42e-35	168	396	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.42e-35	168	396	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000570	0.235674	0.763366	0.000139	0.000125	0.000108

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_01315.