CAZyme Information: MGYG000003108_00144

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000003108_00144
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000003108_7|CGC1	53343.75	4.6475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003108	1737101	MAG	Sweden	Europe

• Gene Location: Start: 6001; End: 7422 Strand: +

Full Sequence      

MTNPIQFPDGFVFGGATAAYQVEGETRTHGKGKVPWDDFLAAQGRFSPDPASDFYNKYPV
DIDLCQRFGINGIRVSIAWSRIFPSGTGEINPEGVAFYHELFATCNKAGVIPYVTLDHFD
TPEAFYQNGGEGFLTRTTIDAFVEYAKFCFAEFTEVKHWFTFNEIPATAEGSFIVGNWPH
GEKYRLDKAFQLMHNMMVAHAKAVVAFHEGGFEGEIGIVQNLEPKYPLDPNSAADCEAAR
MADVINNRWVLDATFRGHYAADTMEAATKLAHIAGGELDVRDEDIAALTAALPYNDCLGV
NTYKCQFLRAAEGENDINHNGTGDKGSSRWFLKGVGESCVREGVPTTDWDWIIYPEGLYD
LLLRIKNDYPNYKKIYITENGMGYKDDFEDGFIDDAPRIDYMRQHLAWILKAIDGGVNVD
GYFVWSLQDQFSWTNGYNKRYGLFYIDFETQKRYPKASAYWYKNVAETGLLMA

Enzyme Prediction     

EC	3.2.1.85

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	468	7e-141	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13511	PRK13511	0.0	6	468	4	465	6-phospho-beta-galactosidase; Provisional
TIGR01233	lacG	0.0	6	468	3	463	6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00232	Glyco_hydro_1	4.06e-175	4	468	2	450	Glycosyl hydrolase family 1.
COG2723	BglB	4.10e-175	6	469	3	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	3.17e-65	7	465	4	468	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70624.1	0.0	5	473	1	469
ATP54908.1	0.0	5	473	1	469
QIA34772.1	0.0	5	473	1	469
QIA33912.1	5.24e-245	1	468	8	475
ATP54168.1	1.06e-244	1	468	8	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PBG_A	3.50e-206	8	471	6	467	TheThree-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis [Lactococcus lactis],1PBG_B The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis [Lactococcus lactis],3PBG_A 6-Phospho-Beta-Galactosidase Form-C [Lactococcus lactis],3PBG_B 6-Phospho-Beta-Galactosidase Form-C [Lactococcus lactis]
2PBG_A	4.96e-206	8	471	6	467	ChainA, 6-PHOSPHO-BETA-D-GALACTOSIDASE [Lactococcus lactis]
4PBG_A	8.14e-205	8	471	6	467	ChainA, 6-PHOSPHO-BETA-D-GALACTOSIDASE [Lactococcus lactis],4PBG_B Chain B, 6-PHOSPHO-BETA-D-GALACTOSIDASE [Lactococcus lactis]
6Z1H_A	6.88e-120	5	468	9	447	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
4PTV_A	4.36e-92	5	473	5	451	Halothermothrixorenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTV_B Halothermothrix orenii beta-glucosidase A, thiocellobiose complex [Halothermothrix orenii H 168],4PTW_A Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTW_B Halothermothrix orenii beta-glucosidase A, 2-deoxy-2-fluoro-glucose complex [Halothermothrix orenii H 168],4PTX_A Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168],4PTX_B Halothermothrix orenii beta-glucosidase A, glucose complex [Halothermothrix orenii H 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C7N8L9	5.59e-207	6	468	4	464	6-phospho-beta-galactosidase OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) OX=523794 GN=lacG PE=1 SV=1
P11546	1.91e-205	8	471	6	467	6-phospho-beta-galactosidase OS=Lactococcus lactis subsp. lactis OX=1360 GN=lacG PE=1 SV=2
Q6GEP0	2.06e-205	8	468	6	466	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lacG PE=3 SV=1
P67767	2.92e-205	8	468	6	466	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=lacG PE=3 SV=1
Q2YYJ9	2.92e-205	8	468	6	466	6-phospho-beta-galactosidase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003108_00144.