CAZyme Information: MGYG000003112_00990

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E
• CAZyme ID: MGYG000003112_00990
• CAZy Family: CBM74
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	MGYG000003112_199|CGC1	45685.11	3.987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003112	1402119	MAG	Sweden	Europe

• Gene Location: Start: 1787; End: 3055 Strand: -

Full Sequence      

MWEMANTTYIISPEDNFAASNEARPWRNSIPMYLALSIDPSKQATGKAVGTNKDGSTYTN
PFVWGCDGGVAKDGGTSFTTHVDTLIAMDSNNSNGGASIFKADKLDSDGTYMFNYDSRVP
IGVRSFQAQDNQNGFKIKYANGTASDTLYGINSPKGSRILGDNTDMNANWADFFDLGYKD
SYGFIYEVAIPFSTLGIDKDYIETNGIGAMQILTYGTSGMDTLPHDPSMLDNADVEYSYD
PSTSHEKEDVDNITVPLARVGALLDDTVINYAPLEVNFGADLNSGQSAGTTINLKAETYN
STGNVEYEFSINGKSVQKSSSDTYVWTPSETGTYQLSVTATDSDGKSVTENVSYTIGAAQ
KTYEIGDVNLDGVVNVNDATEIQKYGVELVSLNTLQLSLADFNKDGLVNILDATEIQRFV
VL

Enzyme Prediction     

No EC number prediction in MGYG000003112_00990.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM74	1	259	7.2e-89	0.7788461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14256	Dockerin_I	9.26e-13	365	421	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	1.90e-07	366	420	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
PRK14081	PRK14081	4.68e-07	262	372	277	394	triple tyrosine motif-containing protein; Provisional
cd14253	Dockerin	3.78e-05	366	419	1	54	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14254	Dockerin_II	2.06e-04	366	412	1	45	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT06902.1	2.96e-211	1	400	308	707
CDM67953.1	2.24e-57	1	365	844	1190
QZS61962.1	4.71e-51	2	360	42	376
AWX97480.1	7.61e-50	2	360	828	1162
AWX95531.1	7.61e-50	2	360	828	1162

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998280	0.001386	0.000248	0.000020	0.000006	0.000073

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003112_00990.