CAZyme Information: MGYG000003113_00965

Basic Information

• Species: Pauljensenia sp001838165
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp001838165
• CAZyme ID: MGYG000003113_00965
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000003113_6|CGC5	72311.49	4.5406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003113	2324284	MAG	United States	North America

• Gene Location: Start: 145629; End: 147626 Strand: -

Full Sequence      

MKRGPFIAGAGLLGVIALVPALVPSAVAADEQYGATVPYTRYEAEEASRSDGTTLERSDD
IESTAIEASGQSYVALNDKNSSVDFTASTAANALDLRFTLPDHASGRVDVRVNNETVATL
DLSSETAWQYVGGDHVYDEPGDGRKARFRFDEVHTLLGRQVEKDDHIQIVKVGDDQNAYG
IDFIELEQAAPAIERPEGAVSVADYQGAKPGDGVDDSDALIWAMNQAAATSKTVYIPAGT
WEFGRKIGLDHSGLTIQGAGMWHTNVRFTSDQAGGGGFVFNRGVGGVTMTDFYMSSNLKS
RFDEKAQYKGFAGSAGANSRVANVWVEHFECGFWMGDYVDARQMTYTDGMVIENARIRNN
FADGVNFAQGTANSTVRNSSVRGNGDDGLASWSSIDKSTNSQARIAERNSFLGNTVELGW
RASAIGLFGGKSHVIKDNLIVNNFSGAGIRLNTVFDGHNFDLNTDGGISITHNKLVRSGT
TNDFYGNTRGAIDFQEVKGDIRNVTVSDNLIVRPYAEEIRADFGLGQDALSARGITLRDN
KRDDEAVATEQAQIVNHVLVGDQVVRNVPETENYSLYWYQRDERGAHGTIDRYWVSKADG
VAITPDMEYSVEGGKRVYNVTLADLPQYLPTSTDFSGSYDYVADLERSQPADDGTTIVIR
FWSAK

Enzyme Prediction     

No EC number prediction in MGYG000003113_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	32	540	1.8e-138	0.7822445561139029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	6.15e-33	34	186	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	4.53e-08	343	488	4	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam12708	Pectate_lyase_3	2.68e-07	200	446	2	211	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam13229	Beta_helix	7.85e-05	363	512	1	135	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35009.1	0.0	1	665	1	665
CCB93603.1	5.97e-173	33	571	140	675
CCB95088.1	7.29e-173	31	571	138	675
ARI57509.1	1.00e-172	33	571	140	675
ARC49812.1	3.26e-172	31	571	137	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	2.35e-127	32	543	11	526	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	2.46e-43	34	571	54	548	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	1.21e-36	34	459	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	1.33e-35	34	459	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	1.33e-35	34	459	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.999013	0.000183	0.000198	0.000164	0.000140

TMHMM  Annotations     

start	end
7	29