CAZyme Information: MGYG000003114_00307

Basic Information

• Species: Clostridium sp900547475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900547475
• CAZyme ID: MGYG000003114_00307
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000003114_2|CGC5	31325.79	6.5002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003114	3467094	MAG	United States	North America

• Gene Location: Start: 126573; End: 127391 Strand: -

Full Sequence      

MKSEVNQYVPPIGYDKLIESVDYGTISKVEYYSKNIKTKRKFNIWLPANYNENKKYPVLY
LLHGIGGDENEWLNGGAQYIIGNLMATKNASEMIIIFPNVRARQDDSANPGDIFTLEHFK
AFDNFINDLLNDLIPYVEKNYSVKLGRENTAIAGLSMGGREALYIGFTLYKIFGYIGAFC
PAFGIFKYLNNGVFEEGLFTEENFKIPQDLKTLIMIVKGKDDSIVMNEPIRQHNTLVKNN
VNHIYYEIEGGHDFTVWNHGLYNFLKRIFKDY

Enzyme Prediction     

No EC number prediction in MGYG000003114_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	268	1.3e-46	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	5.37e-29	8	270	52	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	1.30e-21	33	268	16	258	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
pfam00756	Esterase	4.04e-21	33	261	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.91e-11	42	183	37	187	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG0400	YpfH	3.84e-06	57	267	19	204	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ84563.1	5.02e-87	14	270	218	473
QEH70018.1	1.42e-86	14	270	218	473
ADL52399.1	4.34e-86	2	270	56	323
AUG57748.1	4.79e-64	10	270	8	258
AMP98728.1	1.46e-60	13	270	38	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXU_A	4.64e-59	19	269	19	270	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]
1JJF_A	7.61e-56	9	266	15	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.14e-55	9	266	15	255	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZN_A	2.08e-35	20	270	126	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	3.00e-28	9	270	121	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	6.17e-51	9	266	34	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	3.69e-25	19	270	424	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	4.15e-20	20	270	137	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	2.69e-18	19	270	493	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	3.41e-09	24	191	827	986	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
163	185