CAZyme Information: MGYG000003114_00473

Basic Information

• Species: Clostridium sp900547475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900547475
• CAZyme ID: MGYG000003114_00473
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000003114_3|CGC2	36655.25	6.8994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003114	3467094	MAG	United States	North America

• Gene Location: Start: 117547; End: 118554 Strand: -

Full Sequence      

MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSSGITGMNLSAEVLKHQPMVEK
YARENGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLL
SSCKNQGIDDLNVAIQSYNYGGGYVGYVAGNEKKHTYNLAENFAKEKSGGKKVTYTNPIA
VAKNGGWRWNYGNMFYVELVNQYLAVPQVSGELAQKVMNEALKYQGWKYVYGGSNPNTSF
DCSGLTQWCYGKAGISLPRTAQAQYDATQHLPLSQAKAGDLVFFHSTYNAGTYVTHVAIY
VGNNQMYHAGNPIGYADLNSSYWQQHLIGAGRVKQ

Enzyme Prediction     

No EC number prediction in MGYG000003114_00473.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	8.80e-60	48	204	1	165	Lysozyme-like.
cd16891	CwlT-like	3.18e-53	54	205	1	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	3.53e-39	226	332	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	3.38e-33	214	333	366	481	invasion associated endopeptidase.
COG0791	Spr	5.31e-28	214	330	75	196	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ67194.1	1.40e-238	1	335	1	335
ARE61274.1	1.40e-238	1	335	1	335
CEJ96888.1	1.40e-238	1	335	1	335
AXB63287.1	1.40e-238	1	335	1	335
AJP10066.1	1.40e-238	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.07e-214	29	335	2	308	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	8.10e-139	30	333	5	310	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
7CFL_A	9.86e-18	214	333	14	137	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
6BIQ_A	1.14e-14	211	320	155	264	Structureof NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_B Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_C Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis],6BIQ_D Structure of NlpC2 from Trichomonas vaginalis [Trichomonas vaginalis]
2K1G_A	7.41e-14	212	333	4	123	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.49e-73	14	334	15	329	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P21171	3.16e-25	217	333	372	484	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2
Q01839	1.88e-24	220	333	415	524	Probable endopeptidase p60 OS=Listeria welshimeri OX=1643 GN=iap PE=3 SV=1
Q01836	6.28e-24	220	333	358	467	Probable endopeptidase p60 OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=iap PE=3 SV=2
Q01837	2.95e-23	220	333	415	524	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.287974	0.707182	0.003810	0.000316	0.000276	0.000416

TMHMM  Annotations     

start	end
7	29