CAZyme Information: MGYG000003114_00540

Basic Information

• Species: Clostridium sp900547475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900547475
• CAZyme ID: MGYG000003114_00540
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
939	MGYG000003114_4|CGC1	106597.27	4.829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003114	3467094	MAG	United States	North America

• Gene Location: Start: 38542; End: 41361 Strand: -

Full Sequence      

MKRNKRLKSIMSLILSILLLLPSVRVYATDSKEEFSKSIQDEVDHLKNQEINDNVSEEIF
QNEGVIVDEETMTNSEITVDGKISDGKGNVGELYEKVDYAVPYSYGDSKFEREELQLKYE
NIYNETRLLNKTEDNYEVALAYSDGSYSFIDSANSIEEAKEKALEEEKKRINGDTIPVIL
NNNGQVVYATFAMGRILKHINGAPDPTFSNNTYVYTSSSLGSEYTYVNHGYVDDVPVIED
IGSAAKVQISGYTGWVKKDVSSSEYDLLIVPINQVSNPSYYINKDGVLYHFISSDLTNSS
QKGYLIKLGVAPSYLKEGVKYLSYDGNYFYDGSDISLGLTNLISDLRNNVKNNSINKNEP
YHTYFNYLPFRSTTTYTAEDLNKFISANTDSSSKLINTGQYFINAQEKYGVNALLALGIA
INESGWGKSTIAQTKNNLFGMNAVDSSPGESANYYKSVELCINEFAKYYISRGYADPADW
RYYGGFLGNKINGANVKYASDPFWGEKASAHAFTADLYLSNNNVTNLNDYDALTVIKYIG
ENSVIDKNKKLLYNISTSINSATACINSVSVVTDKNVKLIDGKYYLEIYPDRTSYIGNGG
SANKFQGEYSFNDKAYVENKNIVFINASKTDILPIDPSSANSWKEYNGNKYYYDKNGVLT
RGWKLIEGYWYYFDTNTAAMKRGWLSYNGQWYYLNQDGKMQTGWQGIEGTWYYFLSSGEA
KTGWLNENGKWYYFNSDCKMQIGWQGIAGTWYYFLSSGEAKTGWLNENGTWYYFNSDCKM
QTGWQKLAGTWYYFISSGEAKTGWLNDNGKWYYFNSDCKMQTGWQGIEGTWYYFLSSGEA
KTGWLNENGKWYYFNSDCKMQIGWQGIAGTWYYFLSSGEAKTGWLNENGKWYYFNSDCKM
QTGWIKVDGKKYYLYSDGSMAVNTTINGIYLGSDGAATR

Enzyme Prediction     

No EC number prediction in MGYG000003114_00540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	399	511	2.2e-21	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	3.75e-69	721	935	442	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.33e-64	662	855	444	637	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	7.07e-61	721	935	485	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	2.47e-60	637	851	439	659	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.85e-57	681	855	485	660	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW42466.1	1.34e-186	4	658	3	691
QQA11780.1	1.36e-176	79	651	26	605
ALG48000.1	2.19e-176	79	659	26	625
AWS25220.1	5.38e-176	79	659	26	625
ASY50729.1	5.38e-176	79	659	26	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	2.38e-24	220	510	9	277	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	1.29e-22	220	510	377	645	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	1.47e-22	220	510	421	689	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998980	0.000208	0.000172	0.000174	0.000156

TMHMM  Annotations     

start	end
7	29