CAZyme Information: MGYG000003114_00836

Basic Information

• Species: Clostridium sp900547475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900547475
• CAZyme ID: MGYG000003114_00836
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		94876.53	4.264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003114	3467094	MAG	United States	North America

• Gene Location: Start: 24144; End: 26690 Strand: +

Full Sequence      

MSYGINPISEIDAPGHSLLFTKYVRNNLEEVQKVLPQIKGNINNPRDWELLSLTGESGDW
AIDFMETLYGEYLDSEDPVFLGDTVNIGIDEYWQIQDNEYDGMRNYISRMADTIKESGKE
VRMWGSMLTYFDNKGVDAKQYNDIVIDFWSSYWENAVKRVSEGFKIVNADSNHLYGNPGR
DYRDIVNIEHIFNNWDPTIISGGNLKKGEPNLLGAKTSLWADINNMGVTERDSQERLIRQ
AAVLSEKTWGGTDKDQSFEEYSFKYESLREGPGVTLGAGVDSKSGLVMSYDFTNEKDGII
YDASGNGYDGKIKNGQIVEEDGEAWLKLDGTGEVTTTLKSLDYPYTVQFDLKLSDADNRE
EDICLFDGYDGRLTVKKNGNLGLNRVFFNQDFGYKIPTDEKVELTVVGTQQVTKLYVNGK
LQSVLSRTTGSETDYDHLLSTFVFPLTSIGSGLDGKIANIKAYNKALSPEILDKMSRGES
VSEVNVSQDKSAAGVAQHKGDVGQDVAWKKLRVGWKALDGDGNALDGSHETNVSEKDSYF
EGAYADSSFAVDMQGEYDISKLVLQWDNPPHKFIIQQSKDGETWTDIQEVTGQSVNEIIF
EEPVCTQYLRVKGLQNNGNTFKLREFEAYEQVEKSALESIITQAEEKVQELDLSYSDKKG
YDIFFDAYVMAKALNESVIAEQAEIDAAKESLQIALDSLTEKPEYIKVEKIELFAERDAL
EIGEQIKITGVITPDNATDKTLKWETSDPEVLEVDENGTVTAIKEGKASIKAISPDNVQA
ELIFTVKEKITEKEDEENPEVEIKPEDNNGREDLPKTGTGVTPVATVALAIIITNIGFHL
NKKKDKWC

Enzyme Prediction     

No EC number prediction in MGYG000003114_00836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	3	250	1.4e-24	0.7151335311572701
CBM32	520	626	8.1e-16	0.8387096774193549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06564	GH20_DspB_LnbB-like	8.81e-67	1	251	92	326	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	1.11e-14	4	250	85	303	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.50e-13	3	249	90	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
pfam02368	Big_2	1.38e-10	711	781	3	73	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
COG5492	YjdB	7.25e-10	703	780	176	254	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASY50997.1	8.92e-111	1	635	684	1274
AWS25495.1	8.92e-111	1	635	684	1274
AXH51903.1	2.35e-110	1	635	684	1274
QQA11576.1	8.53e-110	1	635	684	1274
AMN35076.1	1.07e-107	1	634	684	1273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JQF_A	1.20e-25	3	457	309	726	Crystallizationanalysis of a beta-N-acetylhexosaminidase (Am2136) from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UPR7	9.84e-26	3	457	331	748	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
P35838	1.18e-06	718	776	246	304	Uncharacterized protein CA_C0552 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C0552 PE=4 SV=2
P33747	4.55e-06	711	776	40	105	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
818	840