CAZyme Information: MGYG000003114_02866

Basic Information

• Species: Clostridium sp900547475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900547475
• CAZyme ID: MGYG000003114_02866
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000003114_44|CGC2	27876.19	4.5158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003114	3467094	MAG	United States	North America

• Gene Location: Start: 24903; End: 25634 Strand: +

Full Sequence      

MKKKIRYNGLRSYSQRNKRIKLEKICIASIFTIFILYIMILNLRSNIYEEISDLKEVVAM
ENNTQEATLEESKVDPTNQEVYSNTYIDSEKMAFIESISEGAISNYNKYGILPSITMAQA
ILESGWGKSELAVTHNNLFGIKADLRWNGAVATIVTNENYNDSTVANFRKYDSINESIED
HGNFLYENSRYDEYGLFDGNDYRAQAQALEDAGYSTVKNENGEPIYADKLISLIEKYNLM
QYD

Enzyme Prediction     

No EC number prediction in MGYG000003114_02866.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	102	239	7.2e-36	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.69e-54	88	243	40	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.90e-35	93	243	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	1.96e-32	110	236	171	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.38e-26	102	239	4	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	3.18e-24	93	236	175	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ68765.1	1.38e-62	87	243	61	217
CEK39773.1	7.51e-60	87	243	61	217
CEJ75314.1	1.51e-59	87	243	61	217
AUN13203.1	1.51e-59	87	243	61	217
ASW43637.1	3.44e-59	78	243	49	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.44e-20	59	243	2	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	1.66e-14	93	241	3	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.00e-14	93	241	4	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.43e-13	93	241	4	151	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	1.15e-12	94	240	6	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.03e-26	80	243	37	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.52e-15	93	240	162	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P75942	1.15e-13	79	236	134	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	1.15e-13	79	236	134	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P0C2T5	8.99e-13	93	243	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999938	0.000075	0.000000	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
20	42