CAZyme Information: MGYG000003115_01631

Basic Information

• Species: Franconibacter helveticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Franconibacter; Franconibacter helveticus
• CAZyme ID: MGYG000003115_01631
• CAZy Family: AA6
• CAZyme Description: NAD(P)H dehydrogenase (quinone)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000003115_166|CGC1	20682.42	6.0874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003115	3134352	MAG	United States	North America

• Gene Location: Start: 27; End: 623 Strand: -

Full Sequence      

MVKVLVLYYSMYGHIETMAHAVAEGAEKVAGVEVTIKRVPETMPADVFAKAGGKTQNAPV
ATPQELADYDAIIIGTPTRFGNMSGQMRTFFDQTGGLWASGALYGKVASVFSSTGTGGGQ
EQTITSTWTTLAHHGMVIVPIGYGAQELFDISAVRGGTPYGATTIAGGDGSRQPSPEELA
IARYQGEYVAGVAAKLKS

Enzyme Prediction     

No EC number prediction in MGYG000003115_01631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	3	195	2.6e-84	0.9948717948717949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03767	PRK03767	2.21e-132	1	197	1	199	NAD(P)H:quinone oxidoreductase; Provisional
TIGR01755	flav_wrbA	7.57e-113	2	196	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
COG0655	WrbA	1.35e-59	1	197	3	206	Multimeric flavodoxin WrbA [Energy production and conversion].
COG0426	NorV	7.67e-14	3	124	248	349	Flavorubredoxin [Energy production and conversion].
pfam03358	FMN_red	5.43e-12	2	143	1	143	NADPH-dependent FMN reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS94766.1	2.84e-65	2	197	3	200
SPT16511.1	1.63e-64	3	198	4	203
SPT18005.1	4.50e-64	3	198	4	203
SPT18006.1	4.50e-64	3	198	4	203
CDM84515.1	6.18e-64	2	197	3	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2R96_A	1.45e-123	1	196	1	196	Crystalstructure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4DY4_A	4.01e-123	3	196	2	195	Highresolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
3ZHO_A	3.29e-122	3	196	2	195	X-raystructure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4LA4_A	2.69e-72	3	196	4	203	Crystalstructure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
5F4B_A	2.02e-68	1	196	4	200	Structureof B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308],5F4B_B Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4TSN0	1.01e-125	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=SeSA_A1183 PE=3 SV=1
B4T2V2	1.01e-125	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Salmonella newport (strain SL254) OX=423368 GN=SNSL254_A1214 PE=3 SV=1
B4TEP2	1.01e-125	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Salmonella heidelberg (strain SL476) OX=454169 GN=SeHA_C1229 PE=3 SV=1
B5R056	1.01e-125	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=SEN0983 PE=3 SV=1
B5FR47	1.01e-125	1	196	1	196	NAD(P)H dehydrogenase (quinone) OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=SeD_A1194 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003115_01631.