CAZyme Information: MGYG000003116_00863

Basic Information

• Species: Clostridium_F tepidum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F tepidum
• CAZyme ID: MGYG000003116_00863
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		92884.2	9.193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003116	2461563	MAG	United States	North America

• Gene Location: Start: 134355; End: 136787 Strand: -

Full Sequence      

MNTVYGGSEKPKIEYKVTGNVQTLPIYKKGQNEQVFFNQWDKTGAPFALVIDDYFQLLVP
QKDKAYMKNMKDFSSIDELILYYHDIFEYYNNLAGLSFNANIQTNKNVPNKYFIKADKSG
AGAGYYGGNHTAETSNSVASFWLSKCWGALHEIGHGYQDDFNRGEVWNNIYAHSFQKKDP
NLNIFKNGWLYNYGKKDSVDNKVNKLWHQDKAKFDTWGLREKLYGYVLLKDKATDAGFTH
FNQEYRKLANTPGFNTSDYKQFDLISKYYGEISKLDFTPVIESFGGTMTEWQKEENRYKN
YKPVAPLNEVVPDNQVSKIQQLLNLETPLSLVTTDELAKTGLKGNVTLNFKIDDFNQIKN
QNLYIMNGEKQVKKITITNQTISLGELPVGIYTIYSTNGHNKSYKIDNHYLRVKEANNNL
TLNYKLRTKSNLVNQEIDFLGLGDGLFATAKVDLESEKLNINVFKKSPHSYFPNEEYVKI
EILDKNNNVTYQKSITGTNAVLENSIQTLKEGYKIRLYHCEPSRLKIKDNKTALTKNKIN
TLVVTSQGLKNEKLNQDLNKELAEKIDSFADKIYSEKLMTKSDCAEAKIEIKLAIDALAE
PLKSEMLKKHKELLPHSTINKENPYVGKHFDFTFKGLGDWVFGQLNLDLSSNEAKIDIKK
GKPHVYFKDESYASLSTKDSKGNTVYTKDFIGDKVNEALVKNIPIKIGYYITIKHQEPKN
RLLITNLDNKLELEKGNSITYKITDGGVEKVPEDEIIKVPKNEWNANKSYNAGDKVDYKG
KTYEAKWWSHGFAPDTKVQNSWETPWKLIS

Enzyme Prediction     

No EC number prediction in MGYG000003116_00863.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03272	Mucin_bdg	4.19e-29	633	747	1	115	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	5.26e-27	438	549	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
cd12215	ChiC_BD	3.32e-12	762	808	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	4.62e-11	763	802	3	41	Chitin-binding domain type 3.
cd12214	ChiA1_BD	2.67e-06	763	796	1	37	chitin-binding domain of Chi A1-like proteins. This group contains proteins related to the chitin binding domain of chitinase A1 (ChiA1) of Bacillus circulans WL-12. Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal and catalytic domain, and 2 fibronectin type III-like domains. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiAi chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUM99413.1	0.0	1	810	117	925
AVQ39155.1	0.0	1	810	117	1063
AVQ44128.1	0.0	1	810	117	1063
QRI51927.1	0.0	1	810	117	925
APH21369.1	0.0	1	810	117	925

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003116_00863.