CAZyme Information: MGYG000003116_00864

Basic Information

• Species: Clostridium_F tepidum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F tepidum
• CAZyme ID: MGYG000003116_00864
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		88064.21	9.4477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003116	2461563	MAG	United States	North America

• Gene Location: Start: 137400; End: 139721 Strand: -

Full Sequence      

MKKKALIIGIINLLIVFGIVNVDTKLVYAYTNATGMYVNPVNEKKADIMTVDWSTTKNAP
NTYWAVHNWNAGGEAGGYAGFQQRPDRRTLHFAIWDPISARQPIKAEYLSSSSTSSRFGG
EGEGMKVETNYDWKPASWYKMTMRNWQEDGHTKFGQWIRDESTKEWKQIAVLDFPVANVN
FNWGTGMFQEDWAGNGQDVRNARLKNFYSRSVSNQHWNSLYQQRIKSQYPEKNWNGGGNS
EYVWVEAGGNTKPSMTSGQIFNINQPSKPDVGTLDFDIINAKYENNSLNISWKLKNQSTP
QFKGKIEIYNNPSMIGTPIKTINNIKSYENSIKKSCQLVSLTGLYAKVVITDLFDNTITK
TVTLTGNNEGNYKGSNFNFDFKGYSDRQFAKLDLNLDKLTSKLTVQNIKTHYYFNDSYAS
ILIQDKNGQTVFYKDFIGNKVNDAMVKDIPLKEGYYLTVKHREYSNRLFLTNVDKNLALD
KGATNTYKISKNQLNPISENEIPNPNKSPYVGKHFDFIFKGLGDWIFGQLNLDLSSNEAK
IDITKGKPHIYFKDSYASLLIKDNEGNIVYTKDFIGDKSNEDLVKNIPVKTGYYIILNHQ
ESKDRLIVTNLDNKLELEKDNNTNYKITDSGLLKVSKGEIPNPSKPIYYGTEFDTLFKGY
ADRVFAKMKIDLSKRQATITTNSGIPHSYFNEYATILIQNSKKETVYSKNFIGTYNYYSN
NETVSVEEGSIITITHLESKDRLKIINTENLSELEKANSVTYQVMNGGLKKIS

Enzyme Prediction     

No EC number prediction in MGYG000003116_00864.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11958	DUF3472	9.39e-40	92	249	3	173	Domain of unknown function (DUF3472). This presumed domain is functionally uncharacterized. This domain is found in bacteria, eukaryotes and viruses. This domain is typically between 174 to 190 amino acids in length. This domain has a single completely conserved residue G that may be functionally important.
pfam03272	Mucin_bdg	2.19e-32	380	494	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	5.30e-27	518	632	1	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
pfam03272	Mucin_bdg	1.57e-17	657	769	2	116	Putative mucin or carbohydrate-binding module. This family is the putative binding domain for the substrates of enhancin, and other similar metallopeptidases. This is not the enzymically active, peptidase, part of the proteins - see pfam13402.
TIGR01076	sortase_fam	2.90e-04	639	746	4	109	LPXTG-site transpeptidase (sortase) family protein. This family includes Staphylococcus aureus sortase, a transpeptidase that attaches surface proteins by the Thr of an LPXTG motif to the cell wall. It also includes a protein required for correct assembly of an LPXTG-containing fimbrial protein, a set of homologous proteins from Streptococcus pneumoniae, in which LPXTG proteins are common. However, related proteins are found in Bacillus subtilis and Methanobacterium thermoautotrophicum, in which LPXTG-mediated cell wall attachment is not known. [Cell envelope, Other, Protein fate, Protein and peptide secretion and trafficking]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUM88102.1	0.0	1	637	1	637
ACA54402.1	0.0	1	645	1	652
AUN10863.1	0.0	1	637	1	637
APH19613.1	0.0	1	640	1	640
AUM91712.1	0.0	1	640	1	640

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001153	0.997950	0.000288	0.000238	0.000173	0.000170

TMHMM  Annotations     

start	end
5	22