CAZyme Information: MGYG000003119_00540

Basic Information

• Species: Capnocytophaga ochracea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga; Capnocytophaga ochracea
• CAZyme ID: MGYG000003119_00540
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	MGYG000003119_10|CGC2	31363.05	6.8785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003119	2451559	MAG	United States	North America

• Gene Location: Start: 33265; End: 34074 Strand: -

Full Sequence      

MKDKKVLYVSSEVLPYSPYSELAKMSFEAPRMVNNNGGQIRIFMPKFGNINERRHQLHEV
IRLSGMNIIINDIDVPLIIKVASIPKERIQVYFIDNDEYFRRTGTLFDGENNMYPDNDER
CIFFAKGIVETVKKLNWLPDIIHIHGWASALLPLYLRTYYKDEPIFSESKIVTSVFDSDY
EGALDSTLINKVAFDGISKKTVDPLKNPTYYNLMRVAIKYSDGVVVVSEDMPEDFQTYLK
NLRKPVLYNSDKETFQDSYREFYTKILKK

Enzyme Prediction     

No EC number prediction in MGYG000003119_00540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	237	1.9e-47	0.4703389830508475

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	8.94e-55	6	245	1	227	Starch synthase catalytic domain.
PRK14098	PRK14098	4.93e-45	5	175	7	178	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	7.84e-38	5	245	1	226	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	6.02e-26	5	245	2	226	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	2.68e-25	5	228	2	205	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU93052.1	1.41e-198	1	269	1	269
ALC98153.1	1.41e-198	1	269	1	269
AVM55029.1	5.73e-198	1	269	1	269
QLF50939.1	5.73e-198	1	269	1	269
ATA80464.1	2.40e-190	1	269	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	3.62e-09	6	193	3	180	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNG_A	1.02e-06	2	228	38	290	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	4.69e-42	5	198	7	201	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B3QR00	8.97e-42	2	228	4	228	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1
Q3B6C3	1.27e-41	2	229	4	229	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
A1BIY8	1.77e-41	5	192	7	195	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1
B4SC83	9.35e-40	5	238	7	243	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003119_00540.