CAZyme Information: MGYG000003119_00587

Basic Information

• Species: Capnocytophaga ochracea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga; Capnocytophaga ochracea
• CAZyme ID: MGYG000003119_00587
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000003119_11|CGC1	49433.2	9.0941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003119	2451559	MAG	United States	North America

• Gene Location: Start: 34117; End: 35391 Strand: -

Full Sequence      

MRKVLIITYYWAPAGGPGVQRWLKFVKYLRDFNIEPIVYIPENPTYPIIDNEIGNDLPTD
IQIIKHPIWEPYAWASLFSKKKTQKISSGIIPRKKVSILDKVLLWIRGNCFIPDARKFWV
KPSVKYLNKFIKENQIETIITTSPPHSVHLIGYELKKLIPHLKWISDFRDPWTTIGYYKD
LRLTKWADKRQHYWEKEVLQQSDLVITTSFKTQKDFQQLTNTPIEVITNGYDEEKTITPP
LSNKFLISHIGSLLSDRNPKILWKILAELVREEPHFAEDFTLCFAGKVSEEIEEDIHHNG
LTPYYINKGYISHQEAISLQKQSQVLLLIEIDSEETQGIIPGKLFEYMISGRPILAIGPH
NWDVTPILTETQTGIFVGYTDASQMKAKIVEFYHQFQHKTLKTNPKEVEQYSRKALTQRL
AQLI

Enzyme Prediction     

No EC number prediction in MGYG000003119_00587.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	7.36e-42	3	421	1	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	7.09e-13	90	424	39	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	2.47e-08	125	422	65	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	7.10e-05	116	358	65	307	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam13439	Glyco_transf_4	6.82e-04	119	235	56	170	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF49202.1	0.0	1	424	1	424
ACU93488.1	0.0	1	424	1	424
AVM54588.1	8.36e-317	1	424	1	424
ALC96553.1	3.46e-316	1	424	1	424
VEI52620.1	9.66e-313	1	424	1	424

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003119_00587.