CAZyme Information: MGYG000003119_00605

Basic Information

• Species: Capnocytophaga ochracea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga; Capnocytophaga ochracea
• CAZyme ID: MGYG000003119_00605
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		57055.44	9.5906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003119	2451559	MAG	United States	North America

• Gene Location: Start: 12248; End: 13732 Strand: +

Full Sequence      

MATIINYAIIIIYCTALVGIFLYSLSMLSLLLNYLKHRKQNDEAPKFNLLDPKEIPYVTI
QLPLYNEKYVVRRLLENIAKLEYPRTKLEIQVLDDSTDESVAETAEIIKELQATGLDIKH
IRRTNREGFKAGALKEGLAIAKGDFVAIFDADFMPQPDWLKRTVVYFKDPEIGVVQTRWG
HINRNYSILTKIQALALDVHFTLEQVGRNSKGYFINFNGTAGIWRKACIYDAGNWEGDTL
TEDLDLSYRAQLKNWKFKYLEDVETPAELPVVISAARSQQFRWNKGGAENFRKTVSRVLA
AKNIGWKTKFHGVMHLLNSSMFLWVFVVSVLSIPMLYIKNQYGHLAWIFHITSFFIISTV
ILFICYWFTYKNLQGKTFDDFLNYIKLFVTFFSVALGFSFHNTVAVLEGHTGKRSEFVRT
PKFNINALSDSWKNNKYINTKLSPNMIVEFLLMLYFLFGLYSAVRLNDFGMFPFHCMLTL
GFGFVFFKSLTSKA

Enzyme Prediction     

No EC number prediction in MGYG000003119_00605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	58	283	2.1e-29	0.9695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06437	CESA_CaSu_A2	4.30e-152	56	287	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06423	CESA_like	1.70e-51	60	243	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	1.10e-45	56	289	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.94e-42	44	405	42	379	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06427	CESA_like_2	1.08e-36	56	286	1	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU91660.1	0.0	1	494	1	494
ALC96874.1	0.0	1	494	1	494
QLF49489.1	0.0	1	494	1	494
AVM54238.1	0.0	1	494	1	494
ATA81048.1	0.0	1	494	1	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	9.44e-20	50	286	122	374	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.02e-19	50	286	134	386	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.02e-19	50	286	135	387	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	4.18e-17	52	292	266	506	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	2.74e-13	38	175	29	160	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XIF5	1.34e-64	54	311	147	409	Probable glucomannan 4-beta-mannosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA7 PE=2 SV=1
Q8S7W0	1.28e-63	56	332	112	389	Probable glucomannan 4-beta-mannosyltransferase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA4 PE=2 SV=1
Q9FNI7	1.30e-63	39	307	74	354	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1
Q67X45	1.87e-63	56	311	115	375	Probable glucomannan 4-beta-mannosyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA3 PE=2 SV=1
Q7PC73	2.15e-63	56	304	134	387	Probable glucomannan 4-beta-mannosyltransferase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
316	338
348	370
382	404
442	464
469	487