CAZyme Information: MGYG000003119_00868

Basic Information

• Species: Capnocytophaga ochracea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga; Capnocytophaga ochracea
• CAZyme ID: MGYG000003119_00868
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		37228.3	7.455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003119	2451559	MAG	United States	North America

• Gene Location: Start: 33746; End: 34717 Strand: -

Full Sequence      

MKRTIQYLLTGGGVVLLSGFLVNAMSVKKEENNIYEQAEAEAAQNPLSAQETHHKSDFSN
DYRVFAIDLPEKLDFAGERVPLEDPDVHERLDRELIVNTYWQSNTLLVLKRANKYFPIIE
PILKRNNIPDDFKYLAIIESGLTNAVSPSGASGFWQLMKPAAQEYGLEVTDQVDERYHIE
KATQAACDYLNKAKRSTGSWTMAAAAYNAGISGMNKQTSFQETNNYYDLWLSSETSRYVF
RILALKEIMKHPKKYGFIFEKKHLYNELPTYNVMVDSTIENLTQFAKSQNITYKDLKLYN
PWLRDKRLDNIDGKAYYIRIPKK

Enzyme Prediction     

No EC number prediction in MGYG000003119_00868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	115	252	2e-21	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	2.78e-55	123	247	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	7.66e-24	74	323	64	313	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.61e-18	118	212	1	97	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.70e-13	135	244	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.58e-10	115	244	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC98022.1	1.15e-238	1	323	2	324
QLF50803.1	1.15e-238	1	323	2	324
ACU92907.1	4.70e-238	1	323	2	324
AVM55168.1	9.49e-238	1	323	2	324
ATA80540.1	4.92e-204	1	323	2	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.51e-19	75	323	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.51e-19	75	323	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.345937	0.511290	0.137921	0.002294	0.001065	0.001477

TMHMM  Annotations     

start	end
5	27