CAZyme Information: MGYG000003121_00733

Basic Information

• Species: Gemella sp002871655
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella; Gemella sp002871655
• CAZyme ID: MGYG000003121_00733
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000003121_12|CGC1	36796.99	9.3971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003121	1764117	MAG	United States	North America

• Gene Location: Start: 41785; End: 42858 Strand: +

Full Sequence      

MSKLQKLVAATAIVSTVGVGLAQIADADTYTVKKGDTLWDIAINNGTTVDQLMQDNNLTS
SLIFPGDKLTYNTTVAQVAQAKEEGYYTVVLGDTLGKISNRFGVSVDQLVKLNNIDNPNL
IYVGTVLKVSENAAAKAEVTVAKATVVENTAEKTVAKVDPVQTVTAKPATAVATPKVEVK
KETPAAAPKAEVKKETPAVAPKAEVKKETPVAAPKAEVKKETPVATAAPSVAAKPAAPAA
AATTQAASSNKGAAIYQAALAQLGRYQDCTMLVTNALKAVGINFHDWPAGYMSLGTVVPA
SQAQPGDLVYYANGGTGLAHIGVYAGNGQAVHGGWLGNQTVLNSANIGSGAVYIRVK

Enzyme Prediction     

No EC number prediction in MGYG000003121_00733.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13914	PRK13914	1.02e-18	1	332	1	455	invasion associated endopeptidase.
PRK06347	PRK06347	3.50e-15	26	172	404	569	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	7.86e-15	25	176	328	505	1,4-beta-N-acetylmuramoylhydrolase.
pfam00877	NLPC_P60	3.85e-14	268	332	15	79	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
cd00118	LysM	6.27e-14	86	129	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI39452.1	2.86e-157	1	357	1	370
AXI26353.1	3.96e-149	1	357	1	336
AME08782.1	3.07e-144	1	357	1	308
SQH56165.1	4.13e-142	1	357	1	328
QGS08598.1	8.95e-141	1	357	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	2.31e-07	30	129	44	160	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34669	2.15e-15	25	135	23	127	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1
Q8CMN2	5.50e-13	30	129	86	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	5.50e-13	30	129	86	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
P54421	8.00e-13	3	128	2	128	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
P39046	1.01e-12	30	131	565	666	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999070	0.000177	0.000173	0.000171	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003121_00733.