CAZyme Information: MGYG000003123_00526

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_00526
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000003123_9|CGC1	55313.57	6.6908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 20534; End: 21961 Strand: +

Full Sequence      

MSKVSLALPEGFILGAAASAWQTEGWSGKKPGQDSYLDAWYKNDRHVWHNGYGPAVATDF
INRYPEDVALMKASGLSHYRTSINWSRFLTDYETATVDEEYAAYLDRWLDEMEAAGIVPM
LCLEHYELPAALLEKYGGWGSKHVVELFVRYAEKAFERFGHRVTRWFTFNEPVVVQTRVY
LDALRWPYEQNSAKWMQWNHHKVLATAKVVALFRRRGQAGTIGVILNPEVTYPRSQAAHD
QRAAELYDLFYNRVFLDPLILGAYPAELLALLRRHEVMFEHDAAELAIIRDNTVDEVGIN
LYYPHRVKAPSRAWHPETPFHPACYYEHFELPGRRMNPSRGWEIYPKIIYDMAQRIKQDY
RNIPWFIAENGMGVENEAQHRGADGEIRDDYRIRFIGEHLYWALKAREEGANCLGYMLWA
FTDNVSPMNAFKNRYGLIEIDLDNQRARRRKKSSHWFAALSESRTLTLTLDDDEK

Enzyme Prediction     

No EC number prediction in MGYG000003123_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	464	2.6e-119	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.63e-152	6	471	2	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.51e-111	8	463	5	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	3.75e-85	7	466	4	468	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	2.65e-55	8	457	4	465	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.94e-54	6	468	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR35139.1	0.0	1	475	1	475
ALX96893.1	8.26e-298	1	475	1	478
QCR63173.1	1.67e-297	1	475	1	478
QII36672.1	3.21e-295	1	475	1	478
QOI56338.1	2.63e-294	1	475	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	5.27e-125	6	457	1	452	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	3.08e-124	6	457	2	453	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	4.05e-121	9	462	21	473	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	1.15e-120	9	462	21	473	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	2.30e-80	5	468	8	452	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.05e-123	9	462	10	461	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	9.14e-62	1	457	1	439	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q75I93	1.72e-61	7	457	42	498	Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1
B3W7I3	6.50e-61	4	463	1	469	6-phospho-beta-galactosidase OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=lacG PE=3 SV=1
P14696	9.09e-61	4	463	1	469	6-phospho-beta-galactosidase OS=Lactobacillus casei OX=1582 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.857273	0.140309	0.001490	0.000357	0.000211	0.000384

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_00526.