CAZyme Information: MGYG000003123_01304

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_01304
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	MGYG000003123_32|CGC1	74975.93	9.6627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 25090; End: 27150 Strand: -

Full Sequence      

MIGIFSAGIARIPHLEQLLPEGVARLASYRQVPARVSAIAVWGHRPSGNRAVAVARRRGL
PVWRLEDGFIRSLGLGVAGSPPCAIVVDQAGIYYDAAQPSTLEYLIQDRVGNAPLYPQAS
RAIDTITRLDLSKYNQAPPYRGPVPAGETVLVVDQTFGDKAVCHGGAGPGDFVRMLETAL
EENPQATVWVKVHPDVLHGKKAGYLADAAREAAARHPRVMLLTSNASPYSLLQHVSRVYA
VTSQYGFEALMAGKAVTCFGLPWYAGWGLTDDRHADAPSLAARRGRASLPDLFAAAYLRY
SRYLDPQSGKAGTLDDLLTWLDMARDHCRERQGTLAAPGLSVWKRAILTPFLKTPDNRVR
FGTSINDAAAGVVWGIKGERQWQQAGHDPALPVWRMEDGFLRSAGLGSHLHPPLSLVLDK
SGIYYDATRPSDLETLLNHGALTDHQRARAAALRQRLLAARLSKYNLGAAFSRPAAAAGK
RLLLVPGQVEDDASILTGTLGIRSNSALLRTVRERHPDAYILYKPHPDVLAGNRKGAVAA
QDVARWANETVLDADIIHCIRAADEIHTLTSLAGFEALMHGKPVTCYGVPFYAGWGLTQD
EYPCPRRTREITLDELVYQALIRYPSYIHPVSGKPITAEAAVSYLETLPRGEMFIAKRKF
SSAINAYKKIKMLIKVKLNYNAAQHL

Enzyme Prediction     

No EC number prediction in MGYG000003123_01304.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	305	649	7.9e-139	0.6597744360902256
GT107	30	311	5e-94	0.5131578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	645	6	639	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.73e-141	372	627	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.92e-135	39	306	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	5.51e-109	372	627	2	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	7.02e-102	39	303	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR36644.1	0.0	1	686	1	686
QMV52384.1	2.55e-314	1	678	1	677
AVL38069.1	3.34e-309	1	679	1	674
ARB84270.1	3.34e-309	1	679	1	674
AJJ20900.1	1.36e-308	1	679	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.23e-140	2	355	3	352	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	7.20e-73	2	321	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	4.63e-72	341	650	10	323	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	1.29e-290	1	677	1	673	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	1.63e-199	6	645	28	671	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	1.31e-198	6	645	28	671	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	3.22e-60	330	666	71	420	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_01304.