CAZyme Information: MGYG000003123_01346

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_01346
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000003123_34|CGC1	44259.36	6.7306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 16516; End: 17703 Strand: +

Full Sequence      

MMSASRLPRGLWLAAGLWLLPLPGSAAPLTHPTDFDENLPLNQAVTQVNPDRSITFRLIA
PHARQVAVVVGALPRTRIAYPMEKDTQGVWHYRLAPQPPNLYEYFFNVDGFRSIDTGSAM
PKPQRQVNTSLVLVPGSLLDDRKVPHGEVHGLTYSSAALNKERHLYVWLPPGYESSTTPL
PVLYVYHGFGDTESSSIVQGRFPQIMDNLLAEKKMQPMVVVFPDTETDSTGAIPENFPRQ
ERRKTFYPLNAAAADQELMQDIIPLIEHRYRVRTDAEGRGIAGISQGGYQALVSGLNHLD
RFRWLASFSGVTTVTVPNSGVAQALENPEMINQQLKNFTLVVGSEDDVTGKDINGLKQQL
DEKKIRVTFHDYPKLGHEMDVWRPAYTEFVQQVFK

Enzyme Prediction     

No EC number prediction in MGYG000003123_01346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	156	391	2.6e-47	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	9.73e-68	100	395	21	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	4.75e-25	52	135	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	5.45e-15	156	388	1	241	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	7.04e-13	145	387	7	252	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG0627	FrmB	3.87e-12	167	385	39	300	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01057.1	5.16e-59	12	395	7	384
BCS41279.1	1.23e-57	31	395	23	374
BBL06292.1	6.24e-56	47	395	52	392
QRQ60217.1	5.60e-54	54	395	50	382
QDT66419.1	2.07e-53	47	395	46	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	7.64e-38	47	395	41	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	1.06e-37	47	395	26	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_A	1.71e-33	47	395	18	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.74e-33	47	395	18	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	2.40e-32	47	395	43	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.69e-164	22	395	26	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	3.86e-37	47	395	330	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	4.46e-26	130	391	30	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	2.18e-22	34	395	381	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	6.83e-06	154	310	179	319	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998857	0.000183	0.000198	0.000168	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_01346.