CAZyme Information: MGYG000003123_02140

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_02140
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003123_78|CGC1	34114.73	6.8863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 9784; End: 10746 Strand: +

Full Sequence      

MSDLNSLSGAAYDAQALNDLKRDVGKDPKAHLKQVAQQFEGVFVTMMLKSMRSALPEGGL
LSNDQTKLYTSMYDQQVAQEMSKKGLGMADMMVKQLSGSNGAPSETAGTVPMALDKEVLN
TLPVQALEQMLRKSVPKMPAASATPVVVAPKLSGDSGEFVSRLSLPAQMASQESGIPHQL
IMAQAALESGWGQREIPTKDGTPSYNLFGVKAGSNWDGPTTDITTTEYENGAAKKIKASF
RVYGSYVEAISDYVRLLTNNPRYAAVAAADTPEQAAHALQKAGYATDPNYASKLVSVIQQ
IKGAGAQAVKAYTHDLSSLF

Enzyme Prediction     

No EC number prediction in MGYG000003123_02140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	167	302	2.6e-36	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	0.0	1	316	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	3.19e-119	10	302	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	3.86e-93	11	301	17	342	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	1.14e-87	11	301	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	1.68e-87	1	308	1	333	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR35787.1	4.82e-192	1	320	2	317
QUT17267.1	2.91e-172	1	320	1	316
QLK61490.1	8.32e-172	1	320	1	316
BBO63556.1	2.85e-167	3	320	4	314
AEX51761.1	4.35e-167	1	320	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	1.30e-73	155	320	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	4.74e-70	155	302	2	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.71e-41	159	298	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	8.78e-41	159	298	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	6.85e-40	159	298	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	7.32e-129	7	320	8	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	4.21e-120	1	320	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	3.43e-119	1	320	2	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9I4P4	2.79e-54	8	302	15	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	2.52e-44	9	302	9	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_02140.