CAZyme Information: MGYG000003123_02337

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_02337
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
148		16945.41	9.7771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 12591; End: 13037 Strand: +

Full Sequence      

MKKVMLFSVLIVSFYSQANDCFDMAGRDYKIDPDLLRAISWNESRFKVDAVGPNPVTGYG
AGLMQIDSQNFPHLSQFGITPQQLKSDACMNIYTGAYYLALAFKRWGMNWDAVGAYNAGF
DKAPRQVERRNKYARKIYNTYINLKSQR

Enzyme Prediction     

No EC number prediction in MGYG000003123_02337.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	31	145	1.1e-17	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13722	PRK13722	4.42e-67	1	148	1	149	lytic transglycosylase; Provisional
cd13400	LT_IagB-like	2.06e-44	29	143	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	8.27e-34	1	145	1	143	type III secretion system invasion protein IagB.
pfam01464	SLT	2.57e-17	22	138	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.16e-13	12	138	133	256	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR38915.1	5.24e-99	1	148	1	148
AXS16923.1	6.40e-70	11	148	12	149
AWE04561.1	3.69e-69	11	148	12	149
QPG02256.1	3.69e-69	11	148	12	149
QGV85602.1	3.69e-69	11	148	12	149

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.78e-16	20	104	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17738	5.27e-67	1	148	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	6.12e-66	1	148	1	149	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
Q00739	6.12e-66	1	148	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P14499	1.23e-65	1	148	1	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P43018	4.24e-24	9	145	9	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000510	0.998239	0.000570	0.000220	0.000216	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_02337.