CAZyme Information: MGYG000003123_02707

Basic Information

• Species: Chimaeribacter coloradensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Chimaeribacter; Chimaeribacter coloradensis
• CAZyme ID: MGYG000003123_02707
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42421.63	7.6827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003123	3803778	MAG	United States	North America

• Gene Location: Start: 6235; End: 7383 Strand: +

Full Sequence      

MQKRPLTIGLVAGETSGDILGAGLIRALKAHHPDTRFVGVAGPLMQAEGCEAWYEMEELA
VMGVVEVVERLPRLLKIRRDLTRRFSELQPDVFVGIDAPDFNITLEGRLKQRGLRTIHYV
SPSVWAWRQKRVFKIGKATDLVLAFLPFEKAFYDKFNVPCRFIGHTLADAMPLQPDKQQA
RQRLGIAAGARCLALLPGSRNAEVEMLSADFLRTALLLRETYPDLEIVVPLVNARRREQF
ERIKAEVAPALPMHLLDGQSRDAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTFW
LAERLIKTPYVSLPNLLAGREIVTELLQHDCVPEKLAAALLPLLAGGGQSEALKQTFLEL
HQHIRCDADEQAAQAVLELAHP

Enzyme Prediction     

No EC number prediction in MGYG000003123_02707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	3.1e-140	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	379	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	5	380	1	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	380	1	375	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	7.75e-174	8	376	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.12e-51	10	334	231	560	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCR35196.1	1.26e-251	1	382	1	382
QHA88298.1	6.68e-247	1	380	1	380
QIP90758.1	1.35e-246	1	380	1	380
ALX96492.1	1.35e-246	1	380	1	380
QXN60447.1	1.35e-246	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.64e-223	2	380	3	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.34e-222	2	380	3	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8GID3	7.06e-243	1	380	1	380	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
C6DAJ6	1.43e-233	1	382	1	382	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1
Q8ZH55	1.52e-233	4	380	16	392	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	1.52e-233	4	380	16	392	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
Q6D8D0	3.22e-230	1	382	1	382	Lipid-A-disaccharide synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003123_02707.