CAZyme Information: MGYG000003126_00196

Basic Information

• Species: Haemophilus_D parainfluenzae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae
• CAZyme ID: MGYG000003126_00196
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000003126_1|CGC4	35321.44	6.2185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003126	1973834	MAG	United States	North America

• Gene Location: Start: 184511; End: 185440 Strand: +

Full Sequence      

MHIEKSICAVVVTFNRKALLLNCLNALKAQTHSLSHIVVIDNASTDGTADFLDEHSWTNN
DAFTLITLPENMGGAGGFHEGIKYAFEQGFDYIWLMDDDGFPAETCLEKLLAYTTENCYI
GPVVIDCEGKEKLSFSLRLPNSLQVLDHYSDIPLSLKIDNQIKDTVLPFNGTLIGRELVQ
QMGFPMKEYFIWGDEREYTMRAEAYSANILTVIDALFYHPIASSISEPMFFGKLRFNNAH
SDLKQYCFCRNTIATFAKHKGFVYALVFFIKTTWFYAFTQPSFSRLLFAWRAMWHGLTGN
FSHHKDYLK

Enzyme Prediction     

No EC number prediction in MGYG000003126_00196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	124	1.8e-28	0.6764705882352942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	8.04e-71	9	253	1	200	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.27e-32	3	296	1	286	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	1.96e-25	9	253	1	234	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	5.92e-18	8	113	1	102	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	6.88e-14	10	117	2	102	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT94684.2	1.94e-216	1	309	1	309
SNV72532.1	1.27e-201	1	309	1	309
QOR21284.1	2.59e-147	1	309	1	308
QIM68103.1	4.12e-146	4	309	2	307
QOR19481.1	1.22e-145	1	309	1	308

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	2.63e-24	7	251	7	250	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	2.19e-19	5	234	3	230	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	2.19e-19	5	234	3	230	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
O32268	7.03e-06	13	185	14	172	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
261	278