CAZyme Information: MGYG000003128_00223

Basic Information

• Species: Corynebacterium simulans
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium simulans
• CAZyme ID: MGYG000003128_00223
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	MGYG000003128_12|CGC1	78319.21	4.7186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003128	1741617	MAG	United States	North America

• Gene Location: Start: 6819; End: 8921 Strand: +

Full Sequence      

MWHVTTRELLEELAQRHGVAAKYSSQSGYPIYVTDETIAYTLRALGVAVEDRASEERLTH
LLYEDYLERASRPLPPCVVAKEGVEKQFLVHVHAGQPVDIQVELEDGQLRQVYQDENNAP
PADVAGTHWGEATFHIPGDLPLGFHEIQISSPGIGAHSCPLIITPARLNTADPYLERPAA
GVMAQLYSVRSENSWGIGDFQDLGRLAQTVAPFADFLLINPLHAAEPVPPVEDSPYLPTT
RRFINPLYLNIESIPELQQLSPELLDDVHELAAEFRERNRSAAEIERDCIYEAKLQVLKE
LYNQEFSAERQNKFMEFQQAEGKGLQDFARWCAEQELSLRTGQRHAVAEEAGELARFYAW
LQFLCDEQLAAAQRRAKEAGMRIGLVTDLAVGVHPGGADAVNLAEYLAPQSSVGAPPDDY
NQQGQDWSQPPWHPVRLAESGYRPWREMLQTILRHSGGVRVDHILGLFRLFWIPRMTSPQ
NGTYVYYDHEAMLGILALEAQRAGAVLVGEDLGTLEPWIQHVLAETGVLGTSIVWFERAE
DNESPLPQHAYRRLALASVGTHDLPPTLAYLRGEHIALRARLGVLTRSVAEEVADDRKWQ
ARLLDEVERTGLLPRREPEEEVVLALHRYIAGTPSALTSTSLVDMVGDVRAQNQPGTTKD
LYPNWCVPLCDSTGTPVLIEDLESNEFFQKMARASARRSD

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	185	675	4.3e-125	0.9554655870445344

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1640	MalQ	5.83e-150	181	698	15	519	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14507	PRK14507	1.45e-140	7	697	5	719	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	2.63e-134	185	669	2	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK11052	malQ	1.94e-128	9	665	5	661	4-alpha-glucanotransferase; Provisional
PRK14510	PRK14510	1.43e-89	179	665	724	1190	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMO92357.1	0.0	4	700	1	697
AMO89824.1	0.0	4	700	1	697
ATZ08418.1	0.0	4	697	7	710
ART20794.1	0.0	4	697	7	710
QQE54028.1	0.0	4	697	1	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	3.95e-291	4	697	1	705	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	1.11e-70	130	665	94	659	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	7.14e-67	130	665	94	659	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
6M6T_A	2.99e-08	349	563	179	397	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P65337	5.06e-199	10	694	8	712	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	5.06e-199	10	694	8	712	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	5.06e-199	10	694	8	712	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P45176	1.86e-76	140	669	110	673	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P15977	5.88e-70	130	665	94	659	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003128_00223.