CAZyme Information: MGYG000003128_01599

Basic Information

• Species: Corynebacterium simulans
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium simulans
• CAZyme ID: MGYG000003128_01599
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622		67047.64	4.204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003128	1741617	MAG	United States	North America

• Gene Location: Start: 42; End: 1910 Strand: +

Full Sequence      

MGNQEASAYPQLGDSVQVSGKVSEFYDATQLTADAVEKLDAALPEVTALELEALPEGDVA
REAYEHMLVLPGTHTVTNNYALNQYGEVGLAPGTEALRQPSDLYDPSTDPDSDLQKLAAS
NAAKLVTLDDGRTKNYLESDQSTPLPYIAQDNAQTIKSLRTTDQVTFQHPVIVGYSHEQW
RYQPTAPVTGNTAGSDLPITWEDSREKELHALDVEGEYTIGAFNVLNYFTSLGEEYGGSS
YDDMDGNPVTVKRGTTRGAYTAEAFENQQRKIVAAVNGLDADVIALSEIEDGYGVTGDKS
KRDQALAHLTDELNAAAGSEKWAYVASPEKLPDTVDVIRTAFIYKKDRVKPVGESRIFVD
DRFTGTAREPLAQEFAPVDAADDETFVAVANHFKSKGSVVKGDADTGDGQGNNPNVRKAQ
AEAVLEHLAKQPDWQDKATFVMGDLNTYTHGDAIDVFRDSGYTVPAEDFHADASYQFSGL
LGSLDHVLANEVASGKVTDAQVWNINADEPVAFEYSRRNYNIVDFYDDSPFRASDHDPVK
VGFSLGEAATTPDEEPDSKPGTNKGSSSSNGSSSGSSTGSIIALILAVAVPGIAMLLGGS
LKFLAPQLIDALPPQVRDFLKF

Enzyme Prediction     

No EC number prediction in MGYG000003128_01599.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033681	ExeM_NucH_DNase	0.0	6	545	42	545	ExeM/NucH family extracellular endonuclease.
COG2374	COG2374	1.61e-133	4	552	260	796	Predicted extracellular nuclease [General function prediction only].
cd10283	MnuA_DNase1-like	3.22e-51	219	543	2	266	Mycoplasma pulmonis MnuA nuclease-like. This subfamily includes Mycoplasma pulmonis MnuA, a membrane-associated nuclease related to Deoxyribonuclease 1 (DNase1 or DNase I, EC 3.1.21.1). The in vivo role of MnuA is as yet undetermined. This subfamily belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.
NF033680	exonuc_ExeM-GG	8.76e-48	3	560	263	860	extracellular exonuclease ExeM. ExeM, as described in Shewanella oneidensis, is a biofilm formation-associated exonuclease that cleaves extracellular DNA (eDNA), a biofilm component. Members of the ExeM family contain two or three pairs of Cys residues, presumed to form disulfide bonds, and a C-terminal GlyGly-CTERM membrane-anchoring segment. Strangely, engineered removal of the GlyGly-CTERM region did not result in net export from the cell and appearance of the enzyme in culture supernatants.
cd04486	YhcR_OBF_like	4.47e-05	6	42	41	78	YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC31565.1	6.56e-118	7	552	307	847
ACZ32093.1	1.08e-116	11	552	300	837
SDS92078.1	4.46e-114	7	555	305	837
QAY64865.1	3.20e-112	11	548	317	850
QAY73698.1	2.12e-111	12	546	370	901

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998562	0.001349	0.000060	0.000007	0.000003	0.000051

TMHMM  Annotations     

start	end
579	601