CAZyme Information: MGYG000003129_01530

Basic Information

• Species: Anaerococcus octavius
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus octavius
• CAZyme ID: MGYG000003129_01530
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000003129_24|CGC1	24773.02	4.3643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003129	1715963	MAG	United States	North America

• Gene Location: Start: 2329; End: 2985 Strand: -

Full Sequence      

MKVLKIIGKIIGYLLLIILLAIVLSYGIIAYQTSRTQINYQDQITETSENFNIDPLLTAS
IVKVESDFDNDAQSHQGAQGLMQLLDETARHSAEVIGMDYYPEKLNDIDYNLNLGVGYYN
YLIKYYNNQKLALAAYNGGVGNVDKWIKDGVLDKNNPDISKIPFDETRQYVTKVEATYDV
YKTFYKDGLPTNEEVSDLGQLSYNNFVTFINQLLYNIA

Enzyme Prediction     

No EC number prediction in MGYG000003129_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	46	181	1.4e-27	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.90e-58	38	180	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.09e-43	40	182	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.50e-33	55	178	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.30e-30	25	185	124	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	1.04e-22	40	194	479	639	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV29351.1	1.49e-106	1	217	1	217
QQN55587.1	1.46e-85	1	217	1	217
QQB62557.1	3.40e-84	1	217	1	217
QQK07141.1	1.04e-46	5	216	2	212
BAG07763.1	6.09e-40	17	214	14	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.93e-18	40	185	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.94e-18	40	185	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.96e-18	40	185	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.98e-18	40	185	430	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.00e-18	40	185	436	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	6.75e-15	35	200	475	643	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	6.75e-15	35	200	475	643	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	3.08e-14	35	194	475	640	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	2.52e-13	31	181	419	571	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31976	6.40e-12	40	178	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.850004	0.131612	0.002925	0.000861	0.000465	0.014150

TMHMM  Annotations     

start	end
10	29