CAZyme Information: MGYG000003131_02602

Basic Information

• Species: UMGS1260 sp900550105
• Lineage: Bacteria; Firmicutes_C; Negativicutes; UMGS1260; UMGS1260; UMGS1260; UMGS1260 sp900550105
• CAZyme ID: MGYG000003131_02602
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000003131_79|CGC1	59861.98	9.2554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003131	3664514	MAG	United States	North America

• Gene Location: Start: 7661; End: 9250 Strand: +

Full Sequence      

MRARYMSYSLFFLAFFFYLAFNQIIPVTDPVESNYALTAKEMVLSGNWLSPQIYGQFWYD
KPILIYWLIAGSFSLFGINDFAARLPAALFGAASVVLLFRFITLLYGSTRQALWGSLVLA
TSLEFWMISKLILTDGVMFFFTSLSLGWLYLAFQGRGRSCYVLAYGAAAFAVLTKGPVGI
VLPGLIALLFIALLRNINYLKKLYLLHGFCLMALIAGPWYYAMYTVHGPEFVDTFLGLHN
YMRATVSEHPKDNVFYYYLILVPLSLLPWSGLLFPALWRAIKQAGERELFLLVWFFGFIV
FYSFMATKYLTYVFPAIFPAAVLISVYLEKLYTASVAAANWLWLSGPACFMLAIFGASAY
FIPIALHKIVTATACTLMVLILVFMQMQKKQTMLIVTVCLTTIVSILFLIPNNLIPLANH
RSAKSIVSDLPGDATGAIYGEYQTSAVYYGNVLLPRLILKEEPVNGKNVWAGKYTMPTEM
LQTFLQRSEEKGKYILMKEKEEAGFTSLPEATDFQKIQKHDGNILFYRQ

Enzyme Prediction     

No EC number prediction in MGYG000003131_02602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	421	4.4e-99	0.8018518518518518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.24e-49	24	364	27	370	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.10e-27	30	331	31	336	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.03e-16	60	221	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.85e-07	32	182	32	189	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	3.55e-05	58	332	58	376	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF51769.1	4.59e-153	17	528	17	527
BBB93296.1	1.65e-142	1	529	1	529
AJQ28749.1	2.58e-110	10	522	20	542
QJW45809.1	1.05e-102	8	522	19	543
QJW45810.1	1.05e-102	8	522	19	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.53e-27	27	331	54	367	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	6.03e-32	15	325	16	317	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	2.15e-26	14	332	12	311	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
B4EUL1	5.62e-25	13	331	12	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q4K884	2.92e-23	24	323	52	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
B2VBI7	3.55e-21	4	325	2	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
56	78
85	107
131	153
160	174
178	197
204	226
254	276
289	306
310	329
342	364
369	386
393	415