CAZyme Information: MGYG000003132_00233

Basic Information

• Species: Dysgonomonas sp900556485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900556485
• CAZyme ID: MGYG000003132_00233
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000003132_1|CGC4	37411.91	8.9367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003132	2983269	MAG	United States	North America

• Gene Location: Start: 250379; End: 251359 Strand: +

Full Sequence      

MKKKILLYIIPIIPVCLLAAMLLSNNSQVEVESKTPFVLSMTRSIEVPHKVTFAGEDISL
ERYDLHERFDREINGFTYLHSTTLLLIKKANRYFPIIEPILKENNIPEDFKYLAVIESNL
NHRAVSSASAAGLWQFMPKTAPNYGLEVSSEVDERYSIEKSTVAACKYFKEAYAKYGNWA
SVALSYNAGQGRISGEINKQQAESGLDLWLVDETSRYYFRMLAIKQVFENPYKYGFVITS
KDLYKPIEFKEVVVTQSIPDLADFAKQNGVTYAQLKDFNSWLRDRKLTISARSRSSYTIL
IPTQESLFYKKGDKVKVHDRAWVTND

Enzyme Prediction     

No EC number prediction in MGYG000003132_00233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	93	228	1e-22	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	5.73e-59	101	226	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.61e-25	77	280	92	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.48e-23	96	193	1	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	5.26e-17	113	192	5	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.55e-13	93	230	6	145	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK58445.1	4.17e-164	1	324	1	324
QIK56176.1	2.32e-163	3	324	2	323
BBD44537.1	3.62e-148	1	323	1	321
SCM59513.1	1.87e-143	7	324	6	322
CEA15013.1	3.18e-142	1	325	1	324

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	7.22e-25	53	290	62	300	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	7.22e-25	53	290	62	300	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	7.94e-10	69	193	2	126	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.705785	0.228543	0.064251	0.000306	0.000225	0.000889

TMHMM  Annotations     

start	end
5	24