CAZyme Information: MGYG000003132_00648

Basic Information

• Species: Dysgonomonas sp900556485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900556485
• CAZyme ID: MGYG000003132_00648
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000003132_2|CGC3	35934.89	7.2378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003132	2983269	MAG	United States	North America

• Gene Location: Start: 74511; End: 75452 Strand: -

Full Sequence      

MKYIFWFCLLSFSLLLNAQEKTEYIVDRNGTGDFRNVQEAINAVRTGDPRGMITIRIKNG
VYKEKLILPVHVSKIHFIGEDKEKTIINYDDHANIDKMGTFKTYTFLLSGNDIIMENLTV
ENSSAPMGQAVALHIEGDRMTFRNCRFLGNQDTIYTGRDGARQYFENCYIEGTTDFIFGP
ATVWFEKCVIHCKRNSYITAANTPENIKYGYIFNDCTITLADGINAVYLGRPWRPYAMTL
FMNCNLPKGIKPEGWDNWRNPENEKTARYMEYNNSGEGANISKRVKWSKILTEKESKEYT
VSNVLGGCDNWVP

Enzyme Prediction     

No EC number prediction in MGYG000003132_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	24	305	5.6e-106	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	6.87e-83	26	299	9	290	pectinesterase
pfam01095	Pectinesterase	7.49e-77	25	307	3	297	Pectinesterase.
PLN02432	PLN02432	2.64e-71	26	307	15	288	putative pectinesterase
PLN02682	PLN02682	8.06e-66	25	313	72	368	pectinesterase family protein
COG4677	PemB	1.41e-64	33	307	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53311.1	4.87e-167	18	313	18	313
QIK58728.1	5.66e-166	18	313	18	313
AND21864.1	2.43e-129	18	313	19	314
ALA73615.1	2.43e-129	18	313	19	314
QJR75357.1	2.43e-129	18	313	19	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	6.47e-46	25	307	10	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.13e-42	25	307	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.74e-37	32	284	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.24e-37	32	284	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.46e-33	34	313	18	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.19e-60	26	299	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	7.38e-53	2	312	227	543	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q8GXA1	9.34e-53	21	313	255	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O80722	1.31e-51	18	312	271	577	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1
Q5MFV8	1.45e-51	18	312	278	584	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998802	0.000369	0.000156	0.000161	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003132_00648.