CAZyme Information: MGYG000003132_00801

Basic Information

• Species: Dysgonomonas sp900556485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900556485
• CAZyme ID: MGYG000003132_00801
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680		78639.47	6.3541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003132	2983269	MAG	United States	North America

• Gene Location: Start: 26768; End: 28810 Strand: -

Full Sequence      

MKNKALIILSYVILSLFGIQGIAVANDNYPNNRYPLVRKPYMELPLGNIKAKGWLLEMLE
RQRSGASGQMDKLYPLVMGERNGWLGGDGDQWERGPYWIDGLLPLAYILDDNKLKEKVQP
WVEWALQSQRSDGFFGPEKDYPHESGIQRDNSHDWWPRMVLLKILQQYYSATNDQRVISF
MSKYFKYQLETLPQKPLGNWTFWANYRSGDNLQAVYWLYNITGESFLLDLGNLIHSQGHD
FTKMFLHTNDMQRCNSIHCVNLAQGIKEPGVYYQQSGDKLYLDALKKGFTDIKTYNGQAQ
GMYGGDEGLHGNNPTQGVELCAIVEMMYSLEKLVEITGDMDYMEHLEKVAFNALPTQVTD
DFMYKQYFQQANQVMATRHKRNFYEDVSHGATDVVFGTLNGYPCCFSNMHQGWPKFVQNL
WYATADNGLAALVYSPSEMKAKVGKDGVEVKMLEDTYYPMDDKIRFTLNIESKKVKSVNF
PFHVRIPSWCKEGTISVNGQMLKTAKGGNIEVISRDWNSGDVVELHLPMGIKIDNTWYEN
SISVQRGPLVYGLKIEEDWIKKQHEGDEVRQFGESYWEIRPKTDWNYGIVQFDYNKADEA
FEVRIDREKLKSNYYWNLENAPIELKVKARTISHWKLYNEMTGPLPLSVTRWSDEPIKEV
TLIPYGCTTLRVSQFPVVTR

Enzyme Prediction     

No EC number prediction in MGYG000003132_00801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	110	551	1.6e-32	0.8606870229007634

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.41e-59	80	551	49	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.24e-27	111	551	84	500	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.17e-158	12	678	7	651
ALL07583.1	8.90e-158	25	678	24	651
QNK64903.1	8.95e-154	12	678	1	645
AMP98056.1	2.65e-153	12	678	7	651
ARS39276.1	3.34e-153	32	678	29	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	2.01e-17	313	554	375	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	3.65e-15	74	554	58	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.44e-14	99	656	76	634	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	1.77e-13	74	554	58	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999183	0.000169	0.000151	0.000141	0.000129

TMHMM  Annotations     

start	end
5	24