CAZyme Information: MGYG000003132_01071

Basic Information

• Species: Dysgonomonas sp900556485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900556485
• CAZyme ID: MGYG000003132_01071
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		50565.91	6.6388

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003132	2983269	MAG	United States	North America

• Gene Location: Start: 16205; End: 17521 Strand: +

Full Sequence      

MKKREILSILLILFCLSCSNTSNIGKVTVLTDNDIPTTKVLPKGMKLVWNDEFNGSRLDT
SKWFTNYYSTLDYVYKTNFDDFKANNLPEPEMEFTGKSIILKVNEEKPEKAFWDTGRKVS
SIQTYDWYSNRNHMENSLGGYFEARIKRNAVDSAKQVNVAFWFDSPGPDPRYFVEKGNKA
LDVEGIRPRGQVFEIDLCEYVTTEIVLHGNVSPKGKFERNIGHYIHKGDFKDKWVTHSML
WTPAGLKFYIDGELVKEWWNPYDIKSSNHMMNMFFGAYGRNGEVTMEVDYVRHYQWQLEK
DNHLPNGNFEYDGTLFPWEGTGKITKDNTYNGNYSILLASGDSICQYVYLDHSKQYSLSY
YGTGKGSVLAKIENITSVTGINEDAVETVSDLKSIFTEHHTRFRTNPEYGDHKRTVKVSF
KNTGNESIILDNIRIKDI

Enzyme Prediction     

No EC number prediction in MGYG000003132_01071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	49	294	1.3e-19	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	1.62e-19	51	294	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	5.79e-09	49	294	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
pfam00722	Glyco_hydro_16	8.06e-07	140	292	34	168	Glycosyl hydrolases family 16.
NF033675	NTTRR-F1	1.04e-05	306	377	8	75	NTTRR-F1 domain. NTTRR-F1 (N-terminal To Repetitive Region - Firmicutes 1) is a homology domain found strictly as the N-terminal non-repetitive region of otherwise highly repetitive proteins of various Firmicutes. The repetitive region that follows typically is collagen-like, with every third residue a glycine.
cd02178	GH16_beta_agarase	1.20e-05	51	295	27	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS94739.1	2.47e-103	30	435	39	427
BBN95259.1	7.67e-13	48	334	30	329
ARN55938.1	9.03e-12	43	330	39	309
ALW89234.1	2.31e-11	48	334	30	329
AQQ08858.1	2.91e-11	44	330	48	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UPS_A	1.23e-10	28	335	13	328	GlcNAc[alpha]1-4Galreleasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens],1UPS_B GlcNAc[alpha]1-4Gal releasing endo-[beta]-galactosidase from Clostridium perfringens [Clostridium perfringens]
6T2N_AAA	4.59e-07	34	295	41	303	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000018	1.000037	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003132_01071.