CAZyme Information: MGYG000003132_02099

Basic Information

• Species: Dysgonomonas sp900556485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900556485
• CAZyme ID: MGYG000003132_02099
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000003132_16|CGC2	28726.96	7.0389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003132	2983269	MAG	United States	North America

• Gene Location: Start: 57314; End: 58072 Strand: -

Full Sequence      

MRKSLFILLLLFTGTAFAQFKGASYMIKGYTLPYQVMFPENYDETKKYPLVVFLHGAGER
GEDNEKQLVHGKQFLIDNFYSQNQAIVIAPQCPADNYWSNVERHQLDKMVLTFGVTDEAT
PAMSTLMNLIRNWLSSGKVDVTRVYVGGLSMGGMGTLELLWRMPQTFVAAFPVCGGADMN
KLPFYAKNTAVWIFHGDSDSVVPVENSRNIYKELKELGCDVEYTEYKGVNHNSWDNVFQE
KTLASWLFKHKR

Enzyme Prediction     

No EC number prediction in MGYG000003132_02099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	31	234	7.3e-31	0.8898678414096917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.22e-49	29	252	171	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	3.70e-19	29	250	375	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	1.06e-11	49	247	19	202	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	5.71e-11	49	234	15	202	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
COG1073	FrsA	1.12e-06	29	250	30	297	Fermentation-respiration switch protein FrsA, has esterase activity, DUF1100 family [Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	9.76e-47	32	248	825	1039
ABS60377.1	9.94e-45	32	252	22	245
QDU56037.1	1.54e-35	32	252	801	1007
ACR12533.1	3.10e-28	31	249	63	278
VTR91196.1	5.01e-28	32	252	43	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.71e-49	29	252	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.74e-24	28	252	17	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
5DWD_A	5.63e-07	50	231	43	222	Crystalstructure of esterase PE8 [Pelagibacterium halotolerans B2],5DWD_B Crystal structure of esterase PE8 [Pelagibacterium halotolerans B2]
1ORV_A	9.02e-06	34	237	488	708	CrystalStructure of Porcine Dipeptidyl Peptidase IV (CD26) [Sus scrofa],1ORV_B Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) [Sus scrofa],1ORV_C Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) [Sus scrofa],1ORV_D Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) [Sus scrofa],1ORW_A Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Peptidomimetic Inhibitor [Sus scrofa],1ORW_B Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Peptidomimetic Inhibitor [Sus scrofa],1ORW_C Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Peptidomimetic Inhibitor [Sus scrofa],1ORW_D Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Peptidomimetic Inhibitor [Sus scrofa],2AJ8_A Porcine dipeptidyl peptidase IV (CD26) in complex with 7-Benzyl-1,3-dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (BDPX) [Sus scrofa],2AJ8_B Porcine dipeptidyl peptidase IV (CD26) in complex with 7-Benzyl-1,3-dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (BDPX) [Sus scrofa],2AJ8_C Porcine dipeptidyl peptidase IV (CD26) in complex with 7-Benzyl-1,3-dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (BDPX) [Sus scrofa],2AJ8_D Porcine dipeptidyl peptidase IV (CD26) in complex with 7-Benzyl-1,3-dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (BDPX) [Sus scrofa],2AJB_A Porcine dipeptidyl peptidase IV (CD26) in complex with the tripeptide tert-butyl-Gly-L-Pro-L-Ile (tBu-GPI) [Sus scrofa],2AJB_B Porcine dipeptidyl peptidase IV (CD26) in complex with the tripeptide tert-butyl-Gly-L-Pro-L-Ile (tBu-GPI) [Sus scrofa],2AJB_C Porcine dipeptidyl peptidase IV (CD26) in complex with the tripeptide tert-butyl-Gly-L-Pro-L-Ile (tBu-GPI) [Sus scrofa],2AJB_D Porcine dipeptidyl peptidase IV (CD26) in complex with the tripeptide tert-butyl-Gly-L-Pro-L-Ile (tBu-GPI) [Sus scrofa],2AJC_A Porcine dipeptidyl peptidase IV (CD26) in complex with 4-(2-Aminoethyl)-benzene sulphonyl fluoride (AEBSF) [Sus scrofa],2AJC_B Porcine dipeptidyl peptidase IV (CD26) in complex with 4-(2-Aminoethyl)-benzene sulphonyl fluoride (AEBSF) [Sus scrofa],2AJC_C Porcine dipeptidyl peptidase IV (CD26) in complex with 4-(2-Aminoethyl)-benzene sulphonyl fluoride (AEBSF) [Sus scrofa],2AJC_D Porcine dipeptidyl peptidase IV (CD26) in complex with 4-(2-Aminoethyl)-benzene sulphonyl fluoride (AEBSF) [Sus scrofa],2AJD_A Porcine dipeptidyl peptidase IV (CD26) in complex with L-Pro-boro-L-Pro (boroPro) [Sus scrofa],2AJD_B Porcine dipeptidyl peptidase IV (CD26) in complex with L-Pro-boro-L-Pro (boroPro) [Sus scrofa],2AJD_C Porcine dipeptidyl peptidase IV (CD26) in complex with L-Pro-boro-L-Pro (boroPro) [Sus scrofa],2AJD_D Porcine dipeptidyl peptidase IV (CD26) in complex with L-Pro-boro-L-Pro (boroPro) [Sus scrofa],2BUA_A Crystal Structure Of Porcine Dipeptidyl Peptidase IV (Cd26) in Complex With a Low Molecular Weight Inhibitor. [Sus scrofa],2BUA_B Crystal Structure Of Porcine Dipeptidyl Peptidase IV (Cd26) in Complex With a Low Molecular Weight Inhibitor. [Sus scrofa],2BUA_C Crystal Structure Of Porcine Dipeptidyl Peptidase IV (Cd26) in Complex With a Low Molecular Weight Inhibitor. [Sus scrofa],2BUA_D Crystal Structure Of Porcine Dipeptidyl Peptidase IV (Cd26) in Complex With a Low Molecular Weight Inhibitor. [Sus scrofa],2BUC_A Crystal Structure Of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Tetrahydroisoquinoline Inhibitor [Sus scrofa],2BUC_B Crystal Structure Of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Tetrahydroisoquinoline Inhibitor [Sus scrofa],2BUC_C Crystal Structure Of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Tetrahydroisoquinoline Inhibitor [Sus scrofa],2BUC_D Crystal Structure Of Porcine Dipeptidyl Peptidase IV (CD26) in Complex with a Tetrahydroisoquinoline Inhibitor [Sus scrofa]
5LLS_A	9.13e-06	34	237	526	746	Porcinedipeptidyl peptidase IV in complex with 8-(3-aminopiperidin-1-yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione [Sus scrofa],5LLS_B Porcine dipeptidyl peptidase IV in complex with 8-(3-aminopiperidin-1-yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione [Sus scrofa],5LLS_C Porcine dipeptidyl peptidase IV in complex with 8-(3-aminopiperidin-1-yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione [Sus scrofa],5LLS_D Porcine dipeptidyl peptidase IV in complex with 8-(3-aminopiperidin-1-yl)-7-[(2-bromophenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione [Sus scrofa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4I8Q4	5.70e-08	51	233	21	215	Acyl-protein thioesterase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRAMPH1_01T20223 PE=3 SV=1
Q7XR62	8.42e-08	51	232	14	202	Probable inactive carboxylesterase Os04g0669700 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669700 PE=3 SV=1
D4AR77	3.65e-07	12	231	368	605	Uncharacterized secreted protein ARB_06907 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_06907 PE=1 SV=2
B0XRV0	1.11e-06	36	250	458	697	Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_024920 PE=1 SV=1
B8NBM3	1.11e-06	36	250	461	700	Probable dipeptidyl-peptidase 5 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=dpp5 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998914	0.000196	0.000159	0.000159	0.000153

TMHMM  Annotations     

start	end
5	27